Overview

  • Product name

  • Description

    Rabbit polyclonal to PDCD2L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human PDCD2L aa 1-358.
    Sequence:

    MAAVLKPVLLGLRDAPVHGSPTGPGAWTASKLGGIPDALPTVAAPRPVCQ RCGQPLALVVQVYCPLEGSPFHRLLHVFACACPGCSTGGARSWKVFRSQC LQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDA SSAKDVDWTARLQDLRLQDAVLGAAHPVPPGLPLFLPYYICVADEDDYRD FVNLDHAHSLLRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTF YKFMKRIAACQEQILRYSWSGEPLFLTCPTSEVTELPACSQCGGQRIFEF QLMPALVSMLKSANLGLSVEFGTILVYTCEKSCWPPNHQTPMEEFCIIQE DPDELLFK


    Database link: Q9BRP1

  • Positive control

    • WB: HeLa and MCF7 whole cell lysates. IHC-P: Human colon cancer and liver cancer tissues.
  • General notes

     This product was previously labelled as MGC13096

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229978 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 39 kDa.

Target

  • Relevance

    MGC13096, also known as PDCD2L, might play a role in apoptosis given evidence that over expression attenutates TNF alpha release in Daudi cells anad restrained proliferation of HEK293T cells.
  • Database links

  • Alternative names

    • MGC144595 antibody
    • PDCD2L antibody
    • Programmed cell death 2 like antibody
    • Programmed cell death protein 2 like antibody

Images

  • All lanes : Anti-PDCD2L antibody (ab229978) at 1/1000 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 39 kDa

  • Paraffin-embedded human colon cancer tissue stained for PDCD2L using ab229978 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver cancer tissue stained for PDCD2L using ab229978 at 1/100 dilution in immunohistochemical analysis.

References

ab229978 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229978.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up