Overview

  • Product name

  • Description

    Rabbit polyclonal to PDE12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human PDE12 aa 368-417. The exact sequence is proprietary.
    Sequence:

    FGLEGVFRIKQHEGLATFYRKSKFSLLSQHDISFYEALESDPLHKELLEK


    Database link: Q6L8Q7

  • Positive control

    • Human ovary tumor lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab177889 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 67 kDa.

Target

  • Function

    Enzyme that cleaves 2',5'-phosphodiester bond linking adenosines of the 5'-triphosphorylated oligoadenylates, triphosphorylated oligoadenylates referred as 2-5A modulates the 2-5A system. This enzyme degraded triphosphorylated 2-5A to produce AMP and ATP. Also cleaves 3',5'-phosphodiester bond of oligoadenylates. Play a role as a negative regulator of the The 2-5A system that is one of the major pathways for antiviral and antitumor functions induced by interferons (IFNs). Suppression of this enzyme induces reduction of viral replication in Hela cells, thus counteracting the antiviral pathway probably by inhibiting the 2-5A system.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the CCR4/nocturin family.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2 PDE antibody
    • 2' 5' phosphodiesterase 12 antibody
    • 2' phosphodiesterase antibody
    • 2',5'-phosphodiesterase 12 antibody
    • 2'-PDE antibody
    • 2-PDE antibody
    • 2PDE antibody
    • DKFZp667B1218 antibody
    • Pde12 antibody
    • PDE12_HUMAN antibody
    • Phosphodiesterase 12 antibody
    see all

Images

  • Anti-PDE12 antibody (ab177889) at 1 µg/ml + Human ovary tumor lysate at 10 µg

    Predicted band size: 67 kDa

References

ab177889 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177889.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up