Overview

  • Product name

  • Description

    Rabbit polyclonal to PDE12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 560-609 (

    LDYIFIDLNALEVEQVIPLPSHEEVTTHQALPSVSHPSDHIALVCDLKWK

    ) of Human PDE12 (NP_808881).

  • Positive control

    • OVCAR-3 cell lysate This antibody gave a positive result when used in the following formaldehyde fixed cell lines: HepG2.

Properties

Applications

Our Abpromise guarantee covers the use of ab87738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 67 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function

    Enzyme that cleaves 2',5'-phosphodiester bond linking adenosines of the 5'-triphosphorylated oligoadenylates, triphosphorylated oligoadenylates referred as 2-5A modulates the 2-5A system. This enzyme degraded triphosphorylated 2-5A to produce AMP and ATP. Also cleaves 3',5'-phosphodiester bond of oligoadenylates. Play a role as a negative regulator of the The 2-5A system that is one of the major pathways for antiviral and antitumor functions induced by interferons (IFNs). Suppression of this enzyme induces reduction of viral replication in Hela cells, thus counteracting the antiviral pathway probably by inhibiting the 2-5A system.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the CCR4/nocturin family.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2 PDE antibody
    • 2' 5' phosphodiesterase 12 antibody
    • 2' phosphodiesterase antibody
    • 2',5'-phosphodiesterase 12 antibody
    • 2'-PDE antibody
    • 2-PDE antibody
    • 2PDE antibody
    • DKFZp667B1218 antibody
    • Pde12 antibody
    • PDE12_HUMAN antibody
    • Phosphodiesterase 12 antibody
    see all

Images

  • ICC/IF image of ab87738 stained HepG2 cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody ab87738 at 10µg/ml overnight at +4°C. The secondary antibody (pseudo-colored green) was Alexa Fluor® 488 goat anti- rabbit (ab150081) IgG (H+L) preadsorbed, used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (pseudo-colored red) at a 1/200 dilution for 1h at room temperature. DAPI was used to stain the cell nuclei (pseudo-colored blue) at a concentration of 1.43µM for 1hour at room temperature.

  • Anti-PDE12 antibody (ab87738) at 1 µg/ml (in 5% skim milk / PBS buffer) + OVCAR-3 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 67 kDa
    Observed band size: 65 kDa
    why is the actual band size different from the predicted?
    Additional bands at: 38 kDa, 45 kDa. We are unsure as to the identity of these extra bands.



    Gel concentration: 12%

References

This product has been referenced in:

  • Toompuu M  et al. Polyadenylation and degradation of structurally abnormal mitochondrial tRNAs in human cells. Nucleic Acids Res 46:5209-5226 (2018). Read more (PubMed: 29518244) »
  • Wood ER  et al. The Role of Phosphodiesterase 12 (PDE12) as a Negative Regulator of the Innate Immune Response and the Discovery of Antiviral Inhibitors. J Biol Chem 290:19681-96 (2015). Read more (PubMed: 26055709) »
See all 4 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab87738.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up