Overview

  • Product name

  • Description

    Rabbit polyclonal to PDE1C/PDE1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human PDE1C/PDE1 aa 431-480 (internal sequence).
    Sequence:

    IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR


    Database link: NP_005011

  • Positive control

    • HepG2 whole cell lysate (ab7900)
  • General notes

     This product was previously labelled as PDE1C

     

Properties

Applications

Our Abpromise guarantee covers the use of ab98194 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 81 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a high affinity for both cAMP and cGMP.
  • Tissue specificity

    Expressed in several tissues, including brain and heart.
  • Sequence similarities

    Belongs to the cyclic nucleotide phosphodiesterase family. PDE1 subfamily.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5''-cyclic nucleotide phosphodiesterase 1C antibody
    • Calcium/calmodulin dependent 3'5' cyclic nucleotide phosphodiesterase 1C antibody
    • Calcium/calmodulin-dependent 3'' antibody
    • Cam PDE 1C antibody
    • Cam-PDE 1C antibody
    • hCam 3 antibody
    • hCam-3 antibody
    • HCAM3 antibody
    • HSPDE1C1A antibody
    • Human 3'5' cyclic nucleotide Phosphodiesterase antibody
    • PDE 1C antibody
    • Pde1c antibody
    • PDE1C_HUMAN antibody
    • Phosphodiesterase 1C antibody
    • Phosphodiesterase 1C calmodulin dependent antibody
    • Phosphodiesterase 1C calmodulin dependent 70kDa antibody
    see all

Images

  • Anti-PDE1C/PDE1 antibody (ab98194) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Predicted band size: 81 kDa



    Gel concentration: 12%

References

ab98194 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab98194.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up