Overview

  • Product name

  • Description

    Rabbit polyclonal to PDE5A/PDE5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog
  • Immunogen

    Recombinant fragment corresponding to Human PDE5A/PDE5 aa 303-442.
    Sequence:

    FAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILK KIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREH DANKINYMYAQYVKNTMEPLNIPDVSKDKRFPWTTENTGN


    Database link: O76074

  • Positive control

    • IGC-P: Human duodenum tissue. ICC/IF: U-2 OS cells.
  • General notes

     This product was previously labelled as PDE5A

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224232 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This phosphodiesterase catalyzes the specific hydrolysis of cGMP to 5'-GMP.
  • Tissue specificity

    Expressed in aortic smooth muscle cells, heart, placenta, skeletal muscle and pancreas and, to a much lesser extent, in brain, liver and lung.
  • Pathway

    Purine metabolism; 3',5'-cyclic GMP degradation; GMP from 3',5'-cyclic GMP: step 1/1.
  • Sequence similarities

    Belongs to the cyclic nucleotide phosphodiesterase family.
    Contains 2 GAF domains.
  • Domain

    Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain which contains two homologous allosteric cGMP-binding regions, A and B.
  • Post-translational
    modifications

    Phosphorylation is regulated by binding of cGMP to the two allosteric sites.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5''-cyclic phosphodiesterase antibody
    • CGB PDE antibody
    • CGB-PDE antibody
    • CGBPDE antibody
    • cGMP binding cGMP specific 3' 5' cyclic nucleotide phosphodiesterase antibody
    • cGMP binding cGMP specific 35 cyclic nucleotide phosphodiesterase antibody
    • cGMP binding cGMP specific phosphodiesterase antibody
    • cGMP binding/cGMP specific phosphodiesterase antibody
    • cGMP specific 3'5' cyclic phosphodiesterase antibody
    • cGMP specific phosphodiesterase PDE5A2 antibody
    • cGMP specific phosphodiesterase type 5A antibody
    • cGMP-binding cGMP-specific phosphodiesterase antibody
    • cGMP-specific 3'' antibody
    • CN5A antibody
    • CN5N antibody
    • PDE 5 antibody
    • PDE 5A antibody
    • PDE5 antibody
    • Pde5a antibody
    • PDE5A_HUMAN antibody
    • PDE5A1 antibody
    • Phosphodiesterase 5A antibody
    • Phosphodiesterase 5A cGMP specific antibody
    • Phosphodiesterase isozyme 5 antibody
    see all

Images

  • Paraffin-embedded human duodenum tissue stained for PDE5A/PDE5 with ab224232 (1/200) in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for PDE5A/PDE5 (green) using ab224232 (4 µg/ml) in ICC/IF.

References

ab224232 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224232.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up