Overview

  • Product name

  • Description

    Rabbit polyclonal to PDE6 alpha
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Dog
  • Immunogen

    Recombinant fragment corresponding to Human PDE6 alpha aa 418-560.
    Sequence:

    TLMESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQK ILKTREVYGKEPWECEEEELAEILQAELPDADKYEINKFHFSDLPLTELE LVKCGIQMYYELKVVDKFHIPQEALVRFMYSLSKGYRKITYHN


    Database link: P16499

  • Positive control

    • IHC-P: Human skeletal muscle tissue. WB: PDE6 alpha overexpression HEK-293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab224389 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 100 kDa.

Target

  • Function

    This protein participates in processes of transmission and amplification of the visual signal.
  • Involvement in disease

    Defects in PDE6A are the cause of retinitis pigmentosa type 43 (RP43) [MIM:613810]. RP43 is a retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well.
  • Sequence similarities

    Belongs to the cyclic nucleotide phosphodiesterase family.
    Contains 2 GAF domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5''-cyclic phosphodiesterase subunit alpha antibody
    • CGPR A antibody
    • GMP PDE alpha antibody
    • GMP-PDE alpha antibody
    • PDE 6 alpha antibody
    • PDE 6A antibody
    • PDE V B1 antibody
    • PDE V-B1 antibody
    • PDE6A antibody
    • PDE6A_HUMAN antibody
    • PDEA antibody
    • Phosphodiesterase 6 alpha antibody
    • Phosphodiesterase 6A alpha subunit antibody
    • Phosphodiesterase 6A antibody
    • Phosphodiesterase 6A cGMP specific rod alpha antibody
    • Retinal Rod Photoreceptor cGMP Phosphodiesterase alpha antibody
    • Rod cGMP specific 3' 5' cyclic phosphodiesterase alpha subunit antibody
    • Rod cGMP-specific 3'' antibody
    see all

Images

  • Paraffin-embedded human cerebral cortex tissue stained for PDE6 alpha using ab224389 at 1/20 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lymph node tissue stained for PDE6 alpha using ab224389 at 1/20 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon tissue stained for PDE6 alpha using ab224389 at 1/20 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skeletal muscle tissue stained for PDE6 alpha using ab224389 at 1/20 dilution in immunohistochemical analysis.

  • All lanes : Anti-PDE6 alpha antibody (ab224389) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : PDE6 alpha overexpression HEK-293T cell lysate (Co-expressed with a C-terminal myc-DDK tag, ~3.1 kDa)

    Predicted band size: 100 kDa

References

ab224389 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224389.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up