Overview

  • Product name

    Anti-PDGFR beta antibody [OTI1D1]
    See all PDGFR beta primary antibodies
  • Description

    Mouse monoclonal [OTI1D1] to PDGFR beta
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PDGFR beta. Protein produced in HEK293T cells.
    Sequence:

    MRLPGAMPALALKGELLLLSLLLLLEPQISQGLVVTPPGPELVLNVSSTF VLTCSGSAPV VWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEY FCTHNDSRGLETDERKRLYIFV PDPTVGFLPNDAEELFIFLTEITEIT IPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFS GIFEDRSYICKTTI GDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN EV VNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCN VTESVNDH QDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVF EAYPPPTVLWFKDNRTLGDS SAGEIALSTRNVSETRYVSELTLVRVKV AEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL ELSESHPDSGEQTVRC RGRGMPQPNIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNV TYWE EEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKVVV ISAILA LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYV DPMQLPYDSTWELPRDQL VLGRTLGSGAFGQVVEATAHGLSHSQATMK VAVKMLKSTARSSEKQALMSELKIMSHLGP HLNVVNLLGACTKGGPIY IITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNAL PVGLPL PSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYD NYVP SAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVH RDLAARNVLICEGKLV KICDFGLARDIMRDSNYISKGSTFLPLKWMAP ESIFNSLYTTLSDVWSFGILLWEIFTLG GTPYPELPMNEQFYNAIKRG YRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER LLGEGYKK KYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGD ND YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEP QDEPEPEPQLELQV EPEPELEQLPDSGCPAPRAEAEDSFL


    Database link: NP_002600

  • Positive control

    • ICC/IF: HeLa cells.
  • General notes

    The clone number has been updated from 1D1 to OTI1D1, both clone numbers name the same clone.

Properties

Applications

Our Abpromise guarantee covers the use of ab156762 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 123 kDa.
ICC/IF 1/100.

Target

  • Function

    Receptor that binds specifically to PDGFB and PDGFD and has a tyrosine-protein kinase activity. Phosphorylates Tyr residues at the C-terminus of PTPN11 creating a binding site for the SH2 domain of GRB2.
  • Involvement in disease

    Note=A chromosomal aberration involving PDGFRB is found in a form of chronic myelomonocytic leukemia (CMML). Translocation t(5;12)(q33;p13) with EVT6/TEL. It is characterized by abnormal clonal myeloid proliferation and by progression to acute myelogenous leukemia (AML).
    Note=A chromosomal aberration involving PDGFRB may be a cause of acute myelogenous leukemia. Translocation t(5;14)(q33;q32) with TRIP11. The fusion protein may be involved in clonal evolution of leukemia and eosinophilia.
    Note=A chromosomal aberration involving PDGFRB may be a cause of juvenile myelomonocytic leukemia. Translocation t(5;17)(q33;p11.2) with SPECC1.
    Defects in PDGFRB are a cause of myeloproliferative disorder chronic with eosinophilia (MPE) [MIM:131440]. A hematologic disorder characterized by malignant eosinophils proliferation. Note=A chromosomal aberration involving PDGFRB is found in many instances of myeloproliferative disorder chronic with eosinophilia. Translocation t(5;12) with ETV6 on chromosome 12 creating an PDGFRB-ETV6 fusion protein.
    Note=A chromosomal aberration involving PDGFRB may be the cause of a myeloproliferative disorder (MBD) associated with eosinophilia. Translocation t(1;5)(q23;q33) that forms a PDE4DIP-PDGFRB fusion protein.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated. Dephosphorylated by PTPRJ at Tyr-751, Tyr-857, Tyr-1009 and Tyr-1021.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beta platelet derived growth factor receptor antibody
    • Beta-type platelet-derived growth factor receptor antibody
    • CD 140B antibody
    • CD140 antigen-like family member B antibody
    • CD140b antibody
    • CD140b antigen antibody
    • IBGC4 antibody
    • IMF1 antibody
    • JTK12 antibody
    • OTTHUMP00000160528 antibody
    • PDGF R beta antibody
    • PDGF Receptor beta antibody
    • PDGF-R-beta antibody
    • PDGFR 1 antibody
    • PDGFR antibody
    • PDGFR beta antibody
    • PDGFR1 antibody
    • PDGFRB antibody
    • PGFRB_HUMAN antibody
    • Platelet derived growth factor receptor 1 antibody
    • Platelet derived growth factor receptor beta antibody
    • Platelet derived growth factor receptor beta polypeptide antibody
    see all

Images

  • Immunofluorescent analysis of HeLa cells labeling PDGFR beta with ab156762 at 1/100.

  • All lanes : Anti-PDGFR beta antibody [OTI1D1] (ab156762) at 1/1000 dilution

    Lane 1 : HEK293T cells transfected with pCMV6-ENTRY control
    Lane 2 : HEK293T cells transfected with pCMV6-ENTRY PDGF Receptor beta

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 123 kDa

References

ab156762 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (kidney, mesangial)
Specification
kidney, mesangial
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2.5% · Temperature: 23°C
Fixative
Paraformaldehyde

Miss. Kara Shumansky

Verified customer

Submitted Mar 01 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up