Overview

  • Product name

  • Description

    Rabbit polyclonal to PDHX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human PDHX aa 220-468. (Expressed in E.coli).
    Sequence:

    VQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQP NAVGTFTEIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDL VKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPFIDISVAVAT DKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISN LGMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLIT


    Database link: O00330

  • Positive control

    • WB: Recombinant human PDHX protein; A431 and HeLa cell lysates; Pig heart lysate. ICC/IF: HeLa cells. IHC-P: Human stomach cancer, breast cancer, prostate cancer, prostate, stomach and bile duct cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232798 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 54 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Required for anchoring dihydrolipoamide dehydrogenase (E3) to the dihydrolipoamide transacetylase (E2) core of the pyruvate dehydrogenase complexes of eukaryotes. This specific binding is essential for a functional PDH complex.
  • Involvement in disease

    Defects in PDHX are the cause of pyruvate dehydrogenase E3-binding protein deficiency (PDHXD) [MIM:245349].
  • Sequence similarities

    Belongs to the 2-oxoacid dehydrogenase family.
    Contains 1 lipoyl-binding domain.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Dihydrolipoamide dehydrogenase binding protein of pyruvate dehydrogenase complex antibody
    • Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex antibody
    • DLDBP antibody
    • E3 binding protein antibody
    • E3-binding protein antibody
    • E3BP antibody
    • Lipoyl containing pyruvate dehydrogenase complex component X antibody
    • Lipoyl-containing pyruvate dehydrogenase complex component X antibody
    • mitochondrial antibody
    • ODPX_HUMAN antibody
    • OPDX antibody
    • PDHX antibody
    • PDX 1 antibody
    • PDX1 antibody
    • Pro X antibody
    • proX antibody
    • Pyruvate dehydrogenase complex component X antibody
    • Pyruvate dehydrogenase complex lipoyl containing component X antibody
    • Pyruvate dehydrogenase complex, E3 binding protein subunit antibody
    • Pyruvate dehydrogenase protein X component antibody
    • Pyruvate dehydrogenase protein X component mitochondrial antibody
    see all

Images

  • Anti-PDHX antibody (ab232798) at 3 µg/ml + Recombinant human PDHX protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 54 kDa

  • All lanes : Anti-PDHX antibody (ab232798) at 3 µg/ml

    Lane 1 : A431 (human epidermoid carcinoma cell line) cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 3 : Pig heart lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 54 kDa

  • Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for PDHX using ab232798 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for PDHX using ab232798 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for PDHX using ab232798 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for PDHX using ab232798 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for PDHX using ab232798 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human bile duct cancer tissue stained for PDHX using ab232798 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for PDHX (green) using ab232798 at 20 μg/ml in ICC/IF. FITC-labeled secondary antibody.

References

ab232798 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232798.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up