Overview

  • Product name
  • Description
    Mouse polyclonal to PDK2
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Human PDK2 aa 1-407. (NP_02602.2).
    Sequence:

    MRWVWALLKNASLAGAPKYIEHFSKFSPSPLSMKQFLDFGSSNACEKTSF TFLRQELPVRLANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLD KDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSNQN IQYFLDRFYLSRISIRMLINQHTLIFDGSTNPAHPKHIGSIDPNCNVSEV VKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLF ELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI ERLFSYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSME GFGTDAVIYLKALSTDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPKN TSTYRVS


    Database link: Q15119

  • Positive control
    • PDK2 transfected 293T cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172065 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 46 kDa.

Target

  • Function
    Inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.
  • Tissue specificity
    Expressed in many tissues, with the highest level in heart and skeletal muscle, intermediate levels in brain, kidney, pancreas and liver, and low levels in placenta and lung.
  • Sequence similarities
    Belongs to the PDK/BCKDK protein kinase family.
    Contains 1 histidine kinase domain.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt
  • Database links
  • Alternative names
    • [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2 antibody
    • mitochondrial antibody
    • PDHK2 antibody
    • PDK2 antibody
    • PDK2_HUMAN antibody
    • Pyruvate dehydrogenase kinase isoform 2 antibody
    • Pyruvate dehydrogenase kinase, isozyme 2 antibody
    • Pyruvate dehydrogenase lipoamide kinase isozyme 2, mitochondrial antibody
    see all

Images

  • All lanes : Anti-PDK2 antibody (ab172065) at 1 µg/ml

    Lane 1 : PDK2 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 46 kDa

References

ab172065 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Abcam has not validated the combination of species/application used in this Abreview.
Application
Western blot
Sample
Hamster Cell lysate - whole cell (Chinese Hamster Ovary Cells)
Gel Running Conditions
Reduced Denaturing (12.5%)
Loading amount
300000 cells
Specification
Chinese Hamster Ovary Cells
Blocking step
Milk as blocking agent for 16 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 4°C

Abcam user community

Verified customer

Submitted May 02 2016

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up