Anti-PDLIM2 antibody (ab246868)
- Datasheet
- References (1)
- Protocols
Overview
-
Product name
Anti-PDLIM2 antibody
See all PDLIM2 primary antibodies -
Description
Rabbit polyclonal to PDLIM2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cynomolgus monkey
-
Immunogen
Recombinant fragment corresponding to Human PDLIM2.
Sequence:SPGHTNGDSSLEVLATRFQGSVRTYTESQSSLRSSYSSPTSLSPRAGSPF SPPPSSSSLTGEAAISRSFQSLACSPGLPAADRLSYSGRPGSRQAGLGRA GDSAVLVLPPSPGPRSSRPSMDSEG
Database link: Q96JY6 -
Positive control
- WB: RT4 and U-251 MG whole cell lysates. IHC-P: Human placenta tissue. ICC/IF: U-2 OS cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab246868 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| WB | Use a concentration of 0.4 µg/ml. Predicted molecular weight: 37 kDa. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Function
Probable adapter protein located at the actin cytoskeleton that promotes cell attachment. Necessary for the migratory capacity of epithelial cells. Overexpression enhances cell adhesion to collagen and fibronectin and suppresses anchorage independent growth. May contribute to tumor cell migratory capacity. -
Sequence similarities
Contains 1 LIM zinc-binding domain.
Contains 1 PDZ (DHR) domain. -
Cellular localization
Cytoplasm > cytoskeleton; Nucleus; Cytoplasm. Nucleus. May be partially nuclear and Cytoplasm > cytoskeleton. Colocalizes with beta-1 integrin (ITGB1) and alpha-actinin but not with paxillin. - Information by UniProt
-
Database links
- Entrez Gene: 64236 Human
- Omim: 609722 Human
- SwissProt: Q9GKU1 Cynomolgus monkey
- SwissProt: Q96JY6 Human
- Unigene: 632034 Human
-
Alternative names
- FLJ34715 antibody
- MYSTIQUE antibody
- OTTHUMP00000162522 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-PDLIM2 antibody (ab246868)PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for PDLIM2 (green) using ab246868at 4 μg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PDLIM2 antibody (ab246868)Paraffin-embedded human placenta tissue stained for PDLIM2 using ab246868 at 1/200 dilution in immunohistochemical analysis. -
Western blot - Anti-PDLIM2 antibody (ab246868)All lanes : Anti-PDLIM2 antibody (ab246868) at 0.4 µg/ml
Lane 1 : RT4 (human urinary bladder cancer cell line) whole cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) whole cell lysate
Predicted band size: 37 kDa
Datasheets and documents
References
This product has been referenced in:
- Joyce MA et al. HCV and flaviviruses hijack cellular mechanisms for nuclear STAT2 degradation: Up-regulation of PDLIM2 suppresses the innate immune response. PLoS Pathog 15:e1007949 (2019). Read more (PubMed: 31374104) »
