Anti-PDLIM2 antibody (ab246868)
Key features and details
- Rabbit polyclonal to PDLIM2
- Suitable for: IHC-P, WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PDLIM2 antibody
See all PDLIM2 primary antibodies -
Description
Rabbit polyclonal to PDLIM2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cynomolgus monkey -
Immunogen
Recombinant fragment corresponding to Human PDLIM2.
Sequence:SPGHTNGDSSLEVLATRFQGSVRTYTESQSSLRSSYSSPTSLSPRAGSPF SPPPSSSSLTGEAAISRSFQSLACSPGLPAADRLSYSGRPGSRQAGLGRA GDSAVLVLPPSPGPRSSRPSMDSEG
Database link: Q96JY6 -
Positive control
- WB: RT4 and U-251 MG whole cell lysates. IHC-P: Human placenta tissue. ICC/IF: U-2 OS cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab246868 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 37 kDa. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Probable adapter protein located at the actin cytoskeleton that promotes cell attachment. Necessary for the migratory capacity of epithelial cells. Overexpression enhances cell adhesion to collagen and fibronectin and suppresses anchorage independent growth. May contribute to tumor cell migratory capacity. -
Sequence similarities
Contains 1 LIM zinc-binding domain.
Contains 1 PDZ (DHR) domain. -
Cellular localization
Cytoplasm > cytoskeleton; Nucleus; Cytoplasm. Nucleus. May be partially nuclear and Cytoplasm > cytoskeleton. Colocalizes with beta-1 integrin (ITGB1) and alpha-actinin but not with paxillin. - Information by UniProt
-
Database links
- Entrez Gene: 64236 Human
- Omim: 609722 Human
- SwissProt: Q9GKU1 Cynomolgus monkey
- SwissProt: Q96JY6 Human
- Unigene: 632034 Human
-
Alternative names
- FLJ34715 antibody
- MYSTIQUE antibody
- OTTHUMP00000162522 antibody
see all
Images
-
PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for PDLIM2 (green) using ab246868at 4 μg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PDLIM2 antibody (ab246868)Paraffin-embedded human placenta tissue stained for PDLIM2 using ab246868 at 1/200 dilution in immunohistochemical analysis.
-
All lanes : Anti-PDLIM2 antibody (ab246868) at 0.4 µg/ml
Lane 1 : RT4 (human urinary bladder cancer cell line) whole cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) whole cell lysate
Predicted band size: 37 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (1)
ab246868 has been referenced in 1 publication.
- Joyce MA et al. HCV and flaviviruses hijack cellular mechanisms for nuclear STAT2 degradation: Up-regulation of PDLIM2 suppresses the innate immune response. PLoS Pathog 15:e1007949 (2019). PubMed: 31374104