Overview

  • Product name

  • Description

    Rabbit polyclonal to PDLIM5/ENH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PDLIM5/ENH aa 131-262.
    Sequence:

    PFGSVSSPKVTSIPSPSSAFTPAHATTSSHASPSPVAAVTPPLFAASGLH ANANLSADQSPSALSAGKTAVNVPRQPTVTSVCSETSQELAEGQRRGSQG DSKQQNGPPRKHIVERYTEFYHVPTHSDASKK


    Database link: Q96HC4

  • Positive control

    • IHC-P: Human skeletal muscle tissue. WB: A549 cell lysate. ICC/IF: U-251 MG cells.
  • General notes

     This product was previously labelled as PDLIM5

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224385 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 64 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May play an important role in the heart development by scaffolding PKC to the Z-disk region. May play a role in the regulation of cardiomyocyte expansion. Overexpression promotes the development of heart hypertrophy. Contributes to the regulation of dendritic spine morphogenesis in neurons. May restrain postsynaptic growth of excitatory synapses.
  • Tissue specificity

    Heart and skeletal muscle specific. Expression is commonly increased in the brain of patients with bipolar disorder, schizophrenia, and major depression.
  • Sequence similarities

    Contains 3 LIM zinc-binding domains.
    Contains 1 PDZ (DHR) domain.
  • Cellular localization

    Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Cell junction > synapse > synaptosome. Cytoplasm. Detected both at presynaptic and postsynaptic sites.
  • Information by UniProt
  • Database links

  • Alternative names

    • ENH antibody
    • ENH1 antibody
    • Enigma homolog antibody
    • Enigma like LIM domain protein antibody
    • Enigma like PDZ and LIM domains protein antibody
    • Enigma-like PDZ and LIM domains protein antibody
    • L 9 antibody
    • L9 antibody
    • LIM antibody
    • PDLI5_HUMAN antibody
    • PDLIM5 antibody
    • PDZ and LIM domain 5 antibody
    • PDZ and LIM domain protein 5 antibody
    see all

Images

  • All lanes : Anti-PDLIM5/ENH antibody (ab224385) at 0.4 µg/ml

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Plasma
    Lane 4 : Liver tissue lysate
    Lane 5 : Tonsil tissue lysate

    Predicted band size: 64 kDa

  • Immunohistocehmcial analysis of paraffin-embedded human skeletal muscle staining PDLIM5/ENH with ab224385 at 1/50 dilution.

  • Immunohistocehmcial analysis of paraffin-embedded human heart muscle staining PDLIM5/ENH with ab224385 at 1/50 dilution.

  • Immunohistochemical analysis of human prostate tissue labeling PDLIM5/ENH with ab224385 at 1/50 dilution.

     

  • Immunohistochemical analysis of human testis tissue labeling PDLIM5/ENH with ab224385 at 1/50 dilution.

  • Anti-PDLIM5/ENH antibody (ab224385) at 1/50 dilution + A549 cell lysate

    Predicted band size: 64 kDa

  • Paraffin-embedded human skeletal muscle tissue stained for PDLIM5/ENH using ab224385 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for PDLIM5/ENH (green) using ab224385 at 4 µg/ml in ICC/IF.

References

ab224385 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224385.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up