Overview

  • Product name

  • Description

    Rabbit polyclonal to PDP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat PDP2 aa 1-187. Two N-terminal tags; Expressed in E.coli.
    Sequence:

    MSSTASYRIFNFARNRIAVLRGGRRLYSRAATSRNQVKWRLFSPASLAVN DSSPHGGFALRKAYRHTSTEEEDFHLQLSPEQVSDLLRAGESSHKVLDFN SGVPNSVLRFESNQLAANSP VEDRQGVASCVQTRGTMFGIFDGHGGHA CAQAVSERLFYYMAVSLMSHKTLEQMEEAMENMKPLLPI


    Database link: O88484

  • Positive control

    • IHC-P: Rat stomach, cerebrum and liver tissue. WB: Mouse skeletal muscle lysate, Rat serum; Recombinant rat PDP2 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab233517 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.
  • Sequence similarities

    Belongs to the PP2C family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2 antibody
    • KIAA1348 antibody
    • mitochondrial antibody
    • PDP 2 antibody
    • Pdp2 antibody
    • PDP2_HUMAN antibody
    • PDPC 2 antibody
    • PPM2B antibody
    • PPM2C2 antibody
    • Protein phosphatase 2C magnesium dependent catalytic subunit 2 antibody
    • Protein phosphatase Mg2+/Mn2+ dependent 2B antibody
    • Pyruvate dehydrogenase phosphatase 2 antibody
    • Pyruvate dehydrogenase phosphatase catalytic subunit 2 antibody
    • pyruvate dehydrogenase phosphatase isoenzyme 2 antibody
    • Pyruvate dehydrogenase phosphatase, catalytic subunit 2 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for PDP2 using ab233517 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat cerebrum tissue stained for PDP2 using ab233517 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for PDP2 using ab233517 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PDP2 antibody (ab233517) at 1 µg/ml + Rat serum
  • Anti-PDP2 antibody (ab233517) at 1 µg/ml + Mouse skeletal muscle lysate
  • Anti-PDP2 antibody (ab233517) at 1 µg/ml + Recombinant rat PDP2 protein

References

ab233517 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233517.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up