Overview

  • Product name

    Anti-PDSS2 antibody [OTI1D12]
    See all PDSS2 primary antibodies
  • Description

    Mouse monoclonal [OTI1D12] to PDSS2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cytmore details
  • Species reactivity

    Reacts with: Human, Monkey
  • Immunogen

    Recombinant full length protein corresponding to Human PDSS2 aa 1-399. Produced in HEK-293T cells (NP_065114).
    Sequence:

    MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWN QVVSEAEKIVGYPTSFMSLRCLLSDELSNIAMQVRKLVGTQHPLLTTARG LVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNYDMVSGIYSCQRSLAE ITELIHIALLVHRGIVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANAC NGLALLQNTKVVELLASALMDLVQGVYHENSTSKESYITDDIGISTWKEQ TFLSHGALLAKSCQAAMELAKHDAEVQNMAFQYGKHMAMSHKINSDVQPF IKEKTSDSMTFNLNSAPVVLHQEFLGRDLWIKQIGEAQEKGRLDYAKLRE RIKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS


    Database link: Q86YH6

  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY PDSS2 cDNA; HepG2 and COS7 cell extracts. IHC-P: Human kidney, lung carcinoma, endometrium adenocarcinoma and lymphoma tissues. Flow Cyt: HEK-293T cells transfected with PDSS2 overexpress plasmid.
  • General notes

    Clone OTI1D12 (formerly 1D12).

Properties

Applications

Our Abpromise guarantee covers the use of ab119768 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 44 kDa.
IHC-P 1/150. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Flow Cyt 1/100.

Target

  • Function

    Supplies decaprenyl diphosphate, the precursor for the side chain of the isoprenoid quinones ubiquinone-10.
  • Pathway

    Cofactor biosynthesis; ubiquinone biosynthesis.
  • Involvement in disease

    Defects in PDSS2 are a cause of coenzyme Q10 deficiency (COQ10D) [MIM:607426]. Coenzyme Q10 deficiency is an autosomal recessive disorder with variable manifestations. It can be associated with three main clinical phenotypes: a predominantly myopathic form with central nervous system involvement, an infantile encephalomyopathy with renal dysfunction and an ataxic form with cerebellar atrophy.
  • Sequence similarities

    Belongs to the FPP/GGPP synthase family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • All-trans-decaprenyl-diphosphate synthase subunit 2 antibody
    • bA59I9.3 antibody
    • C6orf210 antibody
    • Candidate tumor suppressor protein antibody
    • chromosome 6 open reading frame 210 antibody
    • Decaprenyl pyrophosphate synthase subunit 2 antibody
    • decaprenyl pyrophosphate synthetase subunit 2 antibody
    • Decaprenyl-diphosphate synthase subunit 2 antibody
    • DLP1 antibody
    • DLP1_HUMAN antibody
    • hDLP1 antibody
    • Pdss2 antibody
    • prenyl (decaprenyl) diphosphate synthase, subunit 2 antibody
    • subunit 2 of decaprenyl diphosphate synthase antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for PDSS2 using ab119768 at 1/150 dilution in immunohistochemical analysis.

  • All lanes : Anti-PDSS2 antibody [OTI1D12] (ab119768) at 1/500 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY PDSS2 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 44 kDa

  • All lanes : Anti-PDSS2 antibody [OTI1D12] (ab119768) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
    Lane 3 : SVT2 cell extract
    Lane 4 : A549 (human lung carcinoma cell line) cell extract
    Lane 5 : COS-7 (african green monkey kidney fibroblast-like cell line) cell extract
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
    Lane 7 : MDCK (canine kidney cell line) cell extract
    Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell extract
    Lane 9 : MCF7 (human breast adenocarcinoma cell line) cell extract

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 44 kDa

  • Paraffin-embedded human lung carcinoma tissue stained for PDSS2 using ab119768 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrium adenocarcinoma tissue stained for PDSS2 using ab119768 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lymphoma tissue stained for PDSS2 using ab119768 at 1/150 dilution in immunohistochemical analysis.

  • Flow cytometric analysis of HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with either PDSS2 overexpress plasmid (Red) or empty vector control plasmid (Blue) labeling pdss2 with ab119768 at 1/100 dilution.

References

This product has been referenced in:

  • Kanda M  et al. Decreased expression of prenyl diphosphate synthase subunit 2 correlates with reduced survival of patients with gastric cancer. J Exp Clin Cancer Res 33:88 (2014). IHC-P ; Human . Read more (PubMed: 25330808) »
  • Kanda M  et al. Clinical utility of PDSS2 expression to stratify patients at risk for recurrence of hepatocellular carcinoma. Int J Oncol 45:2005-12 (2014). Read more (PubMed: 25189544) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab119768.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up