Overview

  • Product name

  • Description

    Rabbit polyclonal to PDXK.1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human PDXK.1 aa 1-312.
    Sequence:

    MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYA HWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQE LKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPN QFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLI VLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPN NLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDI EDPEIVVQATVL


    Database link: O00764

  • Positive control

    • WB: Mouse liver and kidney lysates; HeLa and HepG2 whole cell lysates. IHC-P: Human breast cancer and colon cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab229620 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 35 kDa.
IHC-P 1/20 - 1/200.

Target

Images

  • All lanes : Anti-PDXK.1 antibody (ab229620) at 1/1000 dilution

    Lane 1 : Mouse liver lysate
    Lane 2 : HeLa whole cell lysate
    Lane 3 : Mouse kidney lysate
    Lane 4 : HepG2 whole cell lysate

    Secondary
    All lanes : Goat anti-rabbit IgG at 1/10000 dilution

    Predicted band size: 35 kDa

  • Paraffin-embedded human breast cancer tissue stained for PDXK.1 using ab229620 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon cancer tissue stained for PDXK.1 using ab229620 at 1/100 dilution in immunohistochemical analysis.

References

ab229620 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229620.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up