Overview

  • Product name

  • Description

    Rabbit polyclonal to PDXK.1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat PDXK.1 aa 35-251. Expressed in E. coli. N-terminal tag.
    Sequence:

    VDAVNSVQFSNHTGYAHWKGQVLTSQELHALYEGLKANNVNKYDYVLTGY TRDKSFLGMVVDIVQELKQQNSRLVYVCDPVMGDKWNGEGSMYVPQDLLP VYREKVVPMADIITPNQFEAELLSGRKIHSQEEAFAVMDVLHRMGPDTVV ITSSDLPSPKGSDYLMALGSQRMRKPDGSTVTQRIRMEMRKVDPVFVGTG DLFAAMLLAWTHKHPDN


    Database link: O35331

  • Positive control

    • IHC-P: Rat cerebrum, liver, spinal cord, adrenal gland and pancreas tissue. WB: Recombinant rat PDXK.1 protein. Rat liver and lung tissue lysate. HeLa whole cell lysate (ab150035). Mouse liver tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab232779 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • All lanes : Anti-PDXK.1 antibody (ab232779) at 2 µg/ml

    Lane 1 : Rat liver tissue lysate
    Lane 2 : Rat lung tissue lysate
    Lane 3 : Mouse liver tissue lysate
    Lane 4 : HeLa (Human epithelial cell line from cervix adenocarcinoma) cell lysate

    Secondary
    All lanes : HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded rat pancreas tissue stained for PDXK.1 with ab232779 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat cerebrum tissue stained for PDXK.1 with ab232779 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat adrenal gland tissue stained for PDXK.1 with ab232779 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat spinal cord tissue stained for PDXK.1 with ab232779 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for PDXK.1 with ab232779 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PDXK.1 antibody (ab232779) at 2 µg/ml + Recombinant rat PDXK.1 protein

References

ab232779 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232779.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up