Overview

  • Product name

  • Description

    Rabbit polyclonal to PDXK.1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse PDXK.1 aa 29-285. Two N-terminal tags. Expressed in E.coli.
    Sequence:

    QVLGFEVDAVNSVQFSNHTGYAHWKGQVLKSQELHELYEGLKVNDVNKYD YVLTGYTRDKSFLAMVVDIVRELKQQNSRLVYVCDPVMGDKWNGEGSMYV PQDLLPVYRDKVVPVADIITPNQFEAELLSGRKIHSQEEAFEVMDMLHCM GPDTVVITSSDLPSSQGSDYLIALGSQRMRKPDGSTVTQRIRMEMRKVEA VFVGTGDLFAAMLLAWTHKHPDNLKVACEKTVSAMQHVLQRTIRCAKAEA GEGQKPS


    Database link: Q8K183

  • Positive control

    • IHC-P: Mouse brain, kidney, stomach, oviduct, ovary and uterus tissues. WB: Recombinant mouse PDXK. 1 protein; Mouse liver and lung lysates; Rat liver lysate; HeLa whole cell lysate (ab150035).

Properties

Applications

Our Abpromise guarantee covers the use of ab232812 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 35 kDa.

Target

Images

  • Formalin-fixed, paraffin-embedded mouse uterus tissue stained for PDXK.1 using ab232812 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse ovary tissue stained for PDXK.1 using ab232812 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse oviduct tissue stained for PDXK.1 using ab232812 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse stomach tissue stained for PDXK.1 using ab232812 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for PDXK.1 using ab232812 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse brain tissue stained for PDXK.1 using ab232812 at 10µg/mL in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-PDXK.1 antibody (ab232812) at 2 µg/ml

    Lane 1 : Mouse liver tissue lysate.
    Lane 2 : Mouse lung tissue lysate.
    Lane 3 : Rat liver tissue lysate.
    Lane 4 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 35 kDa

  • Anti-PDXK.1 antibody (ab232812) at 2 µg/ml + Recombinant mouse PDXK. 1 protein.

    Predicted band size: 35 kDa

References

ab232812 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232812.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up