Overview

  • Product name

  • Description

    Rabbit polyclonal to PDXK.1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human PDXK.1 aa 29-253. N-terminal tags. Expressed in E. coli.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGS-QVLGFEIDAVNSVQF SNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAM VVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPL ADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSP QGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLA WTHKHPNNLK


    Database link: O00764

  • Positive control

    • IHC-P: Human skin cancer, glioma, kidney, breast cancer, colorectal cancer and lung cancer tissue. WB: Recombinant human PDXK.1 protein. Human lung tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab233162 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Required for synthesis of pyridoxal-5-phosphate from vitamin B6.
  • Tissue specificity

    Ubiquitous. Isoform 3 is detected in adult testis and spermatozoa.
  • Sequence similarities

    Belongs to the pyridoxine kinase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • pdxK antibody
    • PDXK_HUMAN antibody
    • PKH antibody
    • PNK antibody
    • Pyridoxal kinase antibody
    • Pyridoxamine kinase antibody
    • Pyridoxine kinase antibody
    • Pyridoxine kinase; antibody
    • Vitamin B6 kinase antibody
    see all

Images

  • Anti-PDXK.1 antibody (ab233162) at 2 µg/ml + Human lung tissue lysate

    Secondary
    HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded human skin cancer tissue stained for PDXK.1 with ab233162 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for PDXK.1 with ab233162 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for PDXK.1 with ab233162 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for PDXK.1 with ab233162 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human lung cancer tissue stained for PDXK.1 with ab233162 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for PDXK.1 with ab233162 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PDXK.1 antibody (ab233162) at 2 µg/ml + Recombinant human PDXK.1 protein

References

ab233162 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233162.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up