Overview

  • Product name

  • Description

    Rabbit polyclonal to PDZ-RhoGEF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PDZ-RhoGEF aa 383-527.
    Sequence:

    LQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYG ENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSH AGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKSSNSKKEQDA


    Database link: O15085

  • Positive control

    • IHC-P: Human rectum tissue.
  • General notes

    Previously labelled as ARHGEF11. 

Properties

Applications

Our Abpromise guarantee covers the use of ab223714 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13). Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase and may act as GTPase-activating protein (GAP) for GNA12 and GNA13.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Contains 1 DH (DBL-homology) domain.
    Contains 1 PDZ (DHR) domain.
    Contains 1 PH domain.
    Contains 1 RGSL (RGS-like) domain.
  • Domain

    The poly-Pro region is essential for plasma membrane localization upon stimulation.
  • Cellular localization

    Cytoplasm. Membrane. Translocated to the membrane upon stimulation.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARHGB_HUMAN antibody
    • ARHGEF 11 antibody
    • ARHGEF11 antibody
    • DKFZp667F1223 antibody
    • Glutamate transporter EAAT4 associated protein 48 antibody
    • GTRAP 48 antibody
    • GTRAP48 antibody
    • KIAA0380 antibody
    • OTTHUMP00000038716 antibody
    • OTTHUMP00000038717 antibody
    • PDZ RHOGEF antibody
    • PDZ-RhoGEF antibody
    • Rho guanine exchange factor (GEF) 11 antibody
    • Rho guanine nucleotide exchange factor (GEF) 11 antibody
    • Rho guanine nucleotide exchange factor 11 antibody
    • RhoA specific guanine nucleotide exchange factor antibody
    • RhoGEF glutamate transport modulator antibody
    see all

Images

  • Paraffin embedded sections of human rectum were stained for PDZ-RhoGEF with ab223714 at 1/50 dilution in immunohistochemical analysis.

References

ab223714 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223714.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up