PE Anti-CD63 antibody [MX-49.129.5] (ab205540)
Key features and details
- PE Mouse monoclonal [MX-49.129.5] to CD63
- Suitable for: Flow Cyt
- Reacts with: Human
- Conjugation: PE. Ex: 488nm, Em: 575nm
- Isotype: IgG1
Overview
-
Product name
PE Anti-CD63 antibody [MX-49.129.5]
See all CD63 primary antibodies -
Description
PE Mouse monoclonal [MX-49.129.5] to CD63 -
Host species
Mouse -
Conjugation
PE. Ex: 488nm, Em: 575nm -
Tested applications
Suitable for: Flow Cytmore details -
Species reactivity
Reacts with: Human -
Immunogen
Full length protein corresponding to Human CD63 aa 1-238.
Sequence:MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPG SLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAA AIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAAN YTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLR KNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Database link: P08962 -
Positive control
- Flow Cyt: Human PBMC cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at +4°C. Store In the Dark. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituents: 99% PBS, 0.05% BSA -
Concentration information loading...
-
Purity
Protein A/G purified -
Purification notes
Purified from bioreactor concentrate. -
Clonality
Monoclonal -
Clone number
MX-49.129.5 -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Associated products
-
Alternative Versions
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab205540 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
Flow Cyt | Use 5µl for 106 cells. or 5 µL per 100 µL of whole blood |
Target
-
Function
This antigen is associated with early stages of melanoma tumor progression. May play a role in growth regulation. -
Tissue specificity
Dysplastic nevi, radial growth phase primary melanomas, hematopoietic cells, tissue macrophages. -
Sequence similarities
Belongs to the tetraspanin (TM4SF) family. -
Cellular localization
Cell membrane. Lysosome membrane. Late endosome membrane. Also found in Weibel-Palade bodies of endothelial cells. Located in platelet dense granules. - Information by UniProt
-
Database links
- Entrez Gene: 967 Human
- Omim: 155740 Human
- SwissProt: P08962 Human
- Unigene: 445570 Human
-
Alternative names
- Lysosomal associated membrane protein 3 antibody
- CD 63 antibody
- CD63 antibody
see all
Images
Datasheets and documents
References (0)
ab205540 has not yet been referenced specifically in any publications.