PE Anti-OPA1L antibody [OPAL1-01] (ab191109)
Key features and details
- PE Mouse monoclonal [OPAL1-01] to OPA1L
- Reacts with: Human
- Conjugation: PE. Ex: 488nm, Em: 575nm
- Isotype: IgG2a
Overview
-
Product name
PE Anti-OPA1L antibody [OPAL1-01]
See all OPA1L primary antibodies -
Description
PE Mouse monoclonal [OPAL1-01] to OPA1L -
Host species
Mouse -
Conjugation
PE. Ex: 488nm, Em: 575nm -
Species reactivity
Reacts with: Human
Predicted to work with: Rat -
Immunogen
Recombinant fragment corresponding to Human OPA1L aa 152-342.
Sequence:GSQGAQSSPLSEPSRSSTRPPSIADPDPSDLPVDRAATKAPGMEPSGSVA GLGELDPGAFLDKDAECREELLKDDSSEHGAPDSKEKTPGRHRRFTGDSG IEVCVCNRGHHDDDLKEFNTLIDDALDGPLDFCDSCHVRPPGDEEEGLCQ SSEEQAREPGHPHLPRPPACLLLNTINEQDSPNSQSSSSPS
Database link: Q9NX94 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Store In the Dark. -
Storage buffer
pH: 7.4
Preservative: 0.097% Sodium azide
Constituents: 99% PBS, 0.2% BSA -
Concentration information loading...
-
Purity
Size exclusion -
Purification notes
Purified antibody is conjugated with R-Phycoerythrin (PE) under optimum conditions. The conjugate was purified by size-exclusion chromatography. -
Clonality
Monoclonal -
Clone number
OPAL1-01 -
Isotype
IgG2a -
Research areas
Associated products
-
Isotype control
Target
-
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 54838 Human
- Entrez Gene: 309456 Rat
- Omim: 611129 Human
- SwissProt: Q9NX94 Human
- SwissProt: P0C1G7 Rat
- Unigene: 500897 Human
- Unigene: 105679 Rat
-
Alternative names
- C10orf26 antibody
- FLJ20154 antibody
- OPA1L antibody
see all
Datasheets and documents
References (0)
ab191109 has not yet been referenced specifically in any publications.