For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    pe-pge2-receptor-ep4-subtype-antibody-ab133716.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Signaling Pathway Lipid Signaling Prostaglandins
Share by email

PE Anti-PGE2 receptor EP4 subtype antibody (ab133716)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Key features and details

  • PE Rabbit polyclonal to PGE2 receptor EP4 subtype
  • Reacts with: Mouse, Rat, Sheep, Human
  • Conjugation: PE. Ex: 488nm, Em: 575nm
  • Isotype: IgG

You may also be interested in

Protein
Product image
Recombinant Human PGE2 receptor EP4 subtype protein (ab132115)

View more associated products

Overview

  • Product name

    PE Anti-PGE2 receptor EP4 subtype antibody
    See all PGE2 receptor EP4 subtype primary antibodies
  • Description

    PE Rabbit polyclonal to PGE2 receptor EP4 subtype
  • Host species

    Rabbit
  • Conjugation

    PE. Ex: 488nm, Em: 575nm
  • Species reactivity

    Reacts with: Mouse, Rat, Sheep, Human
    Predicted to work with: Rabbit, Chimpanzee, Baboon, Cynomolgus monkey
  • Immunogen

    Synthetic peptide corresponding to Human PGE2 receptor EP4 subtype aa 459-488 (C terminal).
    Sequence:

    GSGRAGPAPKGSSLQVTFPSETLNLSEKCI

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Jurkat Cells
  • General notes

    Visible absorption maxima 565>540>498. Emission maximum 578 nm.

     This product was previously labelled as Prostaglandin E Receptor EP4

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C.
  • Storage buffer

    pH: 7.40
    Preservative: 0.01% Sodium azide
    Constituents: 1.4% Sodium phosphate, 1.7% Sucrose, 0.88% Sodium chloride, 0.1% BSA
  • Concentration information loading...
  • Purity

    Affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Signaling Pathway
    • Lipid Signaling
    • Prostaglandins
    • Signal Transduction
    • Signaling Pathway
    • G Protein Signaling
    • GPCR

Associated products

  • Isotype control

    • PE-Rabbit IgG - Isotype Control (ab37407)
  • Recombinant Protein

    • Recombinant Human PGE2 receptor EP4 subtype protein (ab132115)

Target

  • Function

    Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. Has a relaxing effect on smooth muscle. May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function.
  • Tissue specificity

    High in intestine and in peripheral blood mononuclear cells; low in lung, kidney, thymus, uterus, vasculature and brain. Not found in liver, heart, retina oe skeletal muscle.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Target information above from: UniProt accession P35408 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 450195 Chimpanzee
    • Entrez Gene: 5734 Human
    • Entrez Gene: 19219 Mouse
    • Entrez Gene: 100009081 Rabbit
    • Entrez Gene: 84023 Rat
    • Entrez Gene: 443222 Sheep
    • Omim: 601586 Human
    • SwissProt: Q95KZ0 Chimpanzee
    • SwissProt: P35408 Human
    • SwissProt: P32240 Mouse
    • SwissProt: Q28691 Rabbit
    • SwissProt: P43114 Rat
    • Unigene: 199248 Human
    • Unigene: 18509 Mouse
    • Unigene: 16062 Rat
    see all
  • Alternative names

    • EP 4 antibody
    • EP4 antibody
    • EP4R antibody
    • MGC126583 antibody
    • PE2R4_HUMAN antibody
    • PGE receptor EP4 subtype antibody
    • PGE2 receptor EP4 subtype antibody
    • Prostaglandin E receptor 4 antibody
    • Prostaglandin E receptor 4 subtype EP4 antibody
    • Prostaglandin E2 receptor antibody
    • Prostaglandin E2 receptor EP4 subtype antibody
    • Prostanoid EP4 receptor antibody
    • PTGER 2 antibody
    • PTGER 4 antibody
    • PTGER2 antibody
    • PTGER4 antibody
    see all

Protocols

  • Flow cytometry protocols

Click here to view the general protocols

Datasheets and documents

    • Datasheet
    • SDS
  • References (0)

    Publishing research using ab133716? Please let us know so that we can cite the reference in this datasheet.

    ab133716 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab133716.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.