PE Anti-PGE2 receptor EP4 subtype antibody (ab133716)
Key features and details
- PE Rabbit polyclonal to PGE2 receptor EP4 subtype
- Reacts with: Mouse, Rat, Sheep, Human
- Conjugation: PE. Ex: 488nm, Em: 575nm
- Isotype: IgG
Overview
-
Product name
PE Anti-PGE2 receptor EP4 subtype antibody
See all PGE2 receptor EP4 subtype primary antibodies -
Description
PE Rabbit polyclonal to PGE2 receptor EP4 subtype -
Host species
Rabbit -
Conjugation
PE. Ex: 488nm, Em: 575nm -
Species reactivity
Reacts with: Mouse, Rat, Sheep, Human
Predicted to work with: Rabbit, Chimpanzee, Baboon, Cynomolgus monkey
-
Immunogen
Synthetic peptide corresponding to Human PGE2 receptor EP4 subtype aa 459-488 (C terminal).
Sequence:GSGRAGPAPKGSSLQVTFPSETLNLSEKCI
-
Positive control
- Jurkat Cells
-
General notes
Visible absorption maxima 565>540>498. Emission maximum 578 nm.This product was previously labelled as Prostaglandin E Receptor EP4
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
pH: 7.40
Preservative: 0.01% Sodium azide
Constituents: 1.4% Sodium phosphate, 1.7% Sucrose, 0.88% Sodium chloride, 0.1% BSA -
Concentration information loading... -
Purity
Affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
Target
-
Function
Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. Has a relaxing effect on smooth muscle. May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function. -
Tissue specificity
High in intestine and in peripheral blood mononuclear cells; low in lung, kidney, thymus, uterus, vasculature and brain. Not found in liver, heart, retina oe skeletal muscle. -
Sequence similarities
Belongs to the G-protein coupled receptor 1 family. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 450195 Chimpanzee
- Entrez Gene: 5734 Human
- Entrez Gene: 19219 Mouse
- Entrez Gene: 100009081 Rabbit
- Entrez Gene: 84023 Rat
- Entrez Gene: 443222 Sheep
- Omim: 601586 Human
- SwissProt: Q95KZ0 Chimpanzee
see all -
Alternative names
- EP 4 antibody
- EP4 antibody
- EP4R antibody
see all
References (0)
ab133716 has not yet been referenced specifically in any publications.
