PE Anti-RLTPR antibody [EM53] (ab232911)
Key features and details
- PE Mouse monoclonal [EM53] to RLTPR
- Suitable for: Flow Cyt
- Reacts with: Human
- Conjugation: PE. Ex: 488nm, Em: 575nm
- Isotype: IgG1
Overview
-
Product name
PE Anti-RLTPR antibody [EM53]
See all RLTPR primary antibodies -
Description
PE Mouse monoclonal [EM53] to RLTPR -
Host species
Mouse -
Conjugation
PE. Ex: 488nm, Em: 575nm -
Tested applications
Suitable for: Flow Cytmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Recombinant fragment corresponding to Mouse RLTPR aa 1147-1397.
Sequence:EAAVGTRPDKRRPLERGDTELAPSFEQRVQVMLQRIGVSRASGGAESKRK QSKDGEIKKAGSDGDIMDSSTETPPISIKSRTHSVSADPSCRPGPGGQGP ESATWKTLGQQLNAELRGRGWGQQDGPGPPSPCPSPSPRRTSPAPDILSL PEDPCLGPRNEDGQLRPRPLSAGRRAVSVHEDQLQAPAERPLRLQRSPVL KRRPKLEAPPSPSLGSGLGSKPLPPYPTEPSSPERSPPSPATDQRGGGPN P
Database link: S0DHL8 -
Positive control
- Flow Cytometry: RLTPR stable transfectants.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Store In the Dark. -
Storage buffer
pH: 7.4
Preservative: 0.0975% Sodium azide
Constituent: PBS -
Concentration information loading...
-
Purity
Size exclusion -
Clonality
Monoclonal -
Clone number
EM53 -
Isotype
IgG1 -
Research areas
Associated products
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab232911 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
Flow Cyt | Use at an assay dependent concentration. |
Target
-
Tissue specificity
Expressed in all tissues tested, including thymus, spleen, colon, leukocytes, peripheral blood, skin, skin keratinocytes and skin fibroblasts. -
Sequence similarities
Belongs to the CARMIL family.
Contains 16 LRR (leucine-rich) repeats. -
Developmental stage
Expressed in fetal skin. - Information by UniProt
-
Database links
- Entrez Gene: 146206 Human
- Entrez Gene: 234695 Mouse
- Omim: 610859 Human
- SwissProt: Q6F5E8 Human
- SwissProt: Q3V3V9 Mouse
- Unigene: 611432 Human
-
Alternative names
- CARMIL2 antibody
- CARMIL2b antibody
- Leucine rich repeat containing 16C antibody
see all
Images
-
Intracellular staining of RLTPR stable transfectants with ab232911.
Recommended negative control: ab125926.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab232911 has not yet been referenced specifically in any publications.