PE Anti-TRAIL antibody [2E5] (ab183474)
Key features and details
- PE Mouse monoclonal [2E5] to TRAIL
- Reacts with: Human
- Conjugation: PE. Ex: 488nm, Em: 575nm
- Isotype: IgG1
Overview
-
Product name
PE Anti-TRAIL antibody [2E5]
See all TRAIL primary antibodies -
Description
PE Mouse monoclonal [2E5] to TRAIL -
Host species
Mouse -
Conjugation
PE. Ex: 488nm, Em: 575nm -
Species reactivity
Reacts with: Human
Does not react with: Mouse -
Immunogen
Recombinant fragment corresponding to Human TRAIL aa 95-281.
Sequence:TSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPNSKNE KALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQE EIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQ GGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG
Database link: P50591 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Store In the Dark. -
Storage buffer
pH: 7.4
Preservative: 0.097% Sodium azide
Constituents: 99% PBS, 0.2% BSA -
Concentration information loading...
-
Purity
Size exclusion -
Purification notes
Purified antibody is conjugated with R-Phycoerythrin (PE) under optimum conditions. The conjugate is purified by size-exclusion chromatography. -
Clonality
Monoclonal -
Clone number
2E5 -
Isotype
IgG1 -
Research areas
Associated products
-
Alternative Versions
-
Isotype control
-
Recombinant Protein
Target
-
Function
Cytokine that binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and possibly also to TNFRSF11B/OPG. Induces apoptosis. Its activity may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and TNFRSF11B/OPG that cannot induce apoptosis. -
Tissue specificity
Widespread; most predominant in spleen, lung and prostate. -
Sequence similarities
Belongs to the tumor necrosis factor family. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 8743 Human
- Omim: 603598 Human
- SwissProt: P50591 Human
- Unigene: 478275 Human
-
Alternative names
- Apo 2 ligand antibody
- APO 2L antibody
- Apo-2 ligand antibody
see all
Datasheets and documents
References (1)
ab183474 has been referenced in 1 publication.
- Hyer ML et al. Synthetic triterpenoids cooperate with tumor necrosis factor-related apoptosis-inducing ligand to induce apoptosis of breast cancer cells. Cancer Res 65:4799-808 (2005). PubMed: 15930300