Anti-Pea3 antibody [1A2G3] (ab70425)
Key features and details
- Mouse monoclonal [1A2G3] to Pea3
- Suitable for: Flow Cyt, WB
- Reacts with: Human, Chinese hamster, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-Pea3 antibody [1A2G3]
See all Pea3 primary antibodies -
Description
Mouse monoclonal [1A2G3] to Pea3 -
Host species
Mouse -
Tested Applications & Species
Application Species Flow Cyt HumanWB HumanRecombinant fragment -
Immunogen
Recombinant fragment corresponding to Human Pea3 aa 50-109.
Sequence:SEDLFQDLSHFQETWLAEAQVPDSDEQFVPDFHSENLAFHSPTTRIKKEP QSPRTDPALS
Database link: P43268 -
Positive control
- Truncated Trx-Pea3 recombinant protein and full length Pea3 hIgGFc transfected CHO-K1 cell lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
1A2G3 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab70425 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Tested applications are guaranteed to work and covered by our Abpromise guarantee.
Predicted to work for this combination of applications and species but not guaranteed.
Does not work for this combination of applications and species.
Application | Species |
---|---|
Flow Cyt |
Human
|
WB |
Human
Recombinant fragment
|
All applications |
Mouse
|
Application | Abreviews | Notes |
---|---|---|
Flow Cyt |
1/50 - 1/100.
ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
|
WB |
1/500 - 1/2000. Detects a band of approximately 60 kDa (predicted molecular weight: 54 kDa).
|
Notes |
---|
Flow Cyt
1/50 - 1/100. ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
WB
1/500 - 1/2000. Detects a band of approximately 60 kDa (predicted molecular weight: 54 kDa). |
Target
-
Function
Transcriptional activator that binds to the enhancer of the adenovirus E1A gene; the core-binding sequence is 5'[AC]GGA[AT]GT-3'. -
Sequence similarities
Belongs to the ETS family.
Contains 1 ETS DNA-binding domain. -
Post-translational
modificationsSumoylated; enhanced upon ERK/MAP kinase pathway activation, it positively regulates the transcriptional activator capacity. Sumoylation at Lys-96 probably requires phosphorylation at Ser-101. Transiently polysumoylated and desumoylated by SENP1. Sumoylation is a prerequisite to polyubiquitination which in turn increases proteasomal-mediated degradation. Probably polyubiquitinated by RNF4 and deubiquitinated by USP2. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 2118 Human
- Entrez Gene: 18612 Mouse
- Omim: 600711 Human
- SwissProt: P43268 Human
- SwissProt: P28322 Mouse
- Unigene: 434059 Human
- Unigene: 5025 Mouse
-
Alternative names
- Adenovirus E1A enhancer binding protein antibody
- Adenovirus E1A enhancer-binding protein antibody
- E1A F antibody
see all
Images
-
All lanes : Anti-Pea3 antibody [1A2G3] (ab70425) at 1/500 dilution
Lane 1 : Truncated Trx-Pea3 recombinant protein
Lane 2 : Full length Pea3 hIgGFc transfected CHO-K1 cell lysate
Predicted band size: 54 kDa
Observed band size: 24,60 kDa why is the actual band size different from the predicted? -
Anti-Pea3 antibody [1A2G3] (ab70425) at 1/2000 dilution + Cell lysates prepared from K562 cells at 100 µg
Secondary
HRP-conjugated Goat polyclonal to mouse IgG1
Predicted band size: 54 kDa -
Overlay histogram showing K562 cells stained with ab70425 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab70425, 1/100 dilution) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in K562 cells fixed with 4% paraformaldehyde (10 min)/permeabilized with 0.1% PBS-Tween for 20 min used under the same conditions.
Datasheets and documents
-
SDS download
-
Datasheet download
References (3)
ab70425 has been referenced in 3 publications.
- Singsuksawat E et al. Increased ETV4 expression correlates with estrogen-enhanced proliferation and invasiveness of cholangiocarcinoma cells. Cancer Cell Int 18:25 (2018). PubMed: 29467595
- Gysin S et al. Analysis of mRNA profiles after MEK1/2 inhibition in human pancreatic cancer cell lines reveals pathways involved in drug sensitivity. Mol Cancer Res 10:1607-19 (2012). WB ; Human . PubMed: 22833572
- Ahmad I et al. K-Ras and ß-catenin mutations cooperate with Fgfr3 mutations in mice to promote tumorigenesis in the skin and lung, but not in the bladder. Dis Model Mech 4:548-55 (2011). IHC . PubMed: 21504907