Overview

  • Product name
  • Description
    Rabbit polyclonal to PEAMT
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human PEAMT aa 1-236. Isoform 2
    Sequence:

    MKRSGNPGAEVTNSSVAGPDCCGGLGNIDFRQADFCVMTRLLGYVDPLDP SFVAAVITITFNPLYWNVVARWEHKTRKLSRAFGSPYLACYSLSVTILLL NFLRSHCFTQAMLSQPRMESLDTPAAYSLGLALLGLGVVLVLSSFFALGF AGTFLGDYFGILKEARVTVFPFNILDNPMYWGSTANYLGWAIMHASPTGL LLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS


    Database link: Q9UBM1-2

  • Positive control
    • PEAMT transfected 293T cell line lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172388 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 26 kDa.

Target

  • Function
    Catalyzes three sequential methylation of phosphatidylethanolamine (PE) by AdoMet, thus producing phosphatidylcholine (PC).
  • Sequence similarities
    Belongs to the PEMT/PEM2 methyltransferase family.
  • Cellular localization
    Endoplasmic reticulum membrane. Mitochondrion membrane. Found in endoplasmic reticulum where most PEMT activity is generated and in mitochondria.
  • Information by UniProt
  • Database links
  • Alternative names
    • PEAMT antibody
    • PEMPT antibody
    • PEMT antibody
    • PEMT_HUMAN antibody
    • PEMT2 antibody
    • phosphatidylethanolamine N methyltransferase antibody
    • Phosphatidylethanolamine N-methyltransferase antibody
    • PNMT antibody
    see all

Images

  • All lanes : Anti-PEAMT antibody (ab172388) at 1 µg/ml

    Lane 1 : PEAMT transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG (H+L), Peroxidase Conjugated at 1/7500 dilution

    Predicted band size: 26 kDa

References

This product has been referenced in:
  • Watanabe M  et al. Pemt deficiency ameliorates endoplasmic reticulum stress in diabetic nephropathy. PLoS One 9:e92647 (2014). WB ; Mouse . Read more (PubMed: 24667182) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172388.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up