Overview

  • Product name

    Anti-Pecanex antibody
  • Description

    Rabbit polyclonal to Pecanex
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Pecanex aa 2059-2145.
    Sequence:

    TGNNATTANNPHSNVTQGSIGNPGQGSGTGLHPPVTSYPPTLGTSHSSHS VQSGLVRQSPARASVASQSSYCYSSRHSSLRMSTTGF


    Database link: Q96RV3

  • Positive control

    • MCF7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220503 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF7 cells labeling Pecanex with ab220503 at 4 µg/ml (green).

References

ab220503 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (MCF-7 cell line)
Gel Running Conditions
Reduced Denaturing (3-8%)
Loading amount
10 µg
Treatment
PCNX targeted & NTC si-RNA for 48hrs
Specification
MCF-7 cell line
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 4°C

Waleed Amri

Verified customer

Submitted Feb 08 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up