Overview

  • Product name

  • Description

    Rabbit polyclonal to PECI/ECI2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human PECI/ECI2 aa 1-241. Two N-terminal tags (Expressed in E.coli).
    Sequence:

    MAMAYLAWRLARRSCPSSLQVTSFPVVQLHMNRTAMRASQKDFENSMNQV KLLKKDPGNEVKLKLYALYKQATEGPCNMPKPGVFDLINKAKWDAWNALG SLPKEAARQNYVDLVSSLSPSLESSSQVEPGTDRKSTGFETLVVTSEDGI TKIMFNRPKKKNAINTEMYHEIMRALKAASKDDSIITVLTGNGDYYSSGN DLTNFTDIPPGGVEEKAKNNAVLLREFVGCFIDFPKPLIAV


    Database link: O75521

  • Positive control

    • IHC-P: Human liver tissue. WB: Pig heart lysate; Human liver lysate; Recombinant human PECI/ECI2 protein.
  • General notes

     This product was previously labelled as PECI

     

Properties

Applications

Our Abpromise guarantee covers the use of ab232953 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 44 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Able to isomerize both 3-cis and 3-trans double bonds into the 2-trans form in a range of enoyl-CoA species. Has a preference for 3-trans substrates.
  • Tissue specificity

    Abundant in heart, skeletal muscle and liver. Expressed in CD34(+) T-cells and CD34(+) bone marrow cells.
  • Sequence similarities

    In the C-terminal section; belongs to the enoyl-CoA hydratase/isomerase family.
    Contains 1 ACB (acyl-CoA-binding) domain.
  • Cellular localization

    Mitochondrion and Peroxisome matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2-trans-enoyl-CoA isomerase antibody
    • ACBD2 antibody
    • acyl Coenzyme A binding domain containing 2 antibody
    • D2-enoyl-CoA isomerase antibody
    • D3 antibody
    • D3 D2 enoyl CoA isomerase antibody
    • DBI related protein 1 antibody
    • DBI-related protein 1 antibody
    • delta(2)-enoyl-CoA isomerase antibody
    • Delta(3) antibody
    • Delta(3) delta(2) enoyl CoA isomerase antibody
    • Diazepam-binding inhibitor-related protein 1 antibody
    • Dodecenoyl CoA isomerase antibody
    • Dodecenoyl-CoA isomerase antibody
    • DRS 1 antibody
    • DRS-1 antibody
    • DRS1 antibody
    • Eci2 antibody
    • ECI2_HUMAN antibody
    • Enoyl-CoA delta isomerase 2 antibody
    • HCA88 antibody
    • Hepatocellular carcinoma associated antigen 88 antibody
    • Hepatocellular carcinoma-associated antigen 88 antibody
    • mitochondrial antibody
    • pECI antibody
    • Peroxisomal 3 antibody
    • Peroxisomal 3,2-trans-enoyl-CoA isomerase antibody
    • Peroxisomal D3 D2 enoyl CoA isomerase antibody
    • Renal carcinoma antigen NY REN 1 antibody
    • Renal carcinoma antigen NY-REN-1 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for PECI/ECI2 using ab232953 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PECI/ECI2 antibody (ab232953) at 2 µg/ml + Human liver tissue lysate

    Predicted band size: 44 kDa

  • Anti-PECI/ECI2 antibody (ab232953) at 2 µg/ml + Pig heart tissue lysate.

    Predicted band size: 44 kDa

  • Anti-PECI/ECI2 antibody (ab232953) at 2 µg/ml + Recombinant human PECI/ECI2 protein

    Predicted band size: 44 kDa

References

ab232953 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232953.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up