Overview

  • Product name

  • Description

    Rabbit polyclonal to PECI/ECI2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human PECI/ECI2 aa 119-219.
    Sequence:

    SPSLESSSQVEPGTDRKSTGFETLVVTSEDGITKIMFNRPKKKNAINTEM YHEIMRALKAASKDDSIITVLTGNGDYYSSGNDLTNFTDIPPGGVEEKAK N


    Database link: O75521

  • Positive control

    • WB: Rat heart lysate; Mouse heart and liver lysates. IHC-P: Human liver tissue.
  • General notes

     This product was previously labelled as PECI

     

Properties

Applications

Our Abpromise guarantee covers the use of ab235322 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 44 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Able to isomerize both 3-cis and 3-trans double bonds into the 2-trans form in a range of enoyl-CoA species. Has a preference for 3-trans substrates.
  • Tissue specificity

    Abundant in heart, skeletal muscle and liver. Expressed in CD34(+) T-cells and CD34(+) bone marrow cells.
  • Sequence similarities

    In the C-terminal section; belongs to the enoyl-CoA hydratase/isomerase family.
    Contains 1 ACB (acyl-CoA-binding) domain.
  • Cellular localization

    Mitochondrion and Peroxisome matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2-trans-enoyl-CoA isomerase antibody
    • ACBD2 antibody
    • acyl Coenzyme A binding domain containing 2 antibody
    • D2-enoyl-CoA isomerase antibody
    • D3 antibody
    • D3 D2 enoyl CoA isomerase antibody
    • DBI related protein 1 antibody
    • DBI-related protein 1 antibody
    • delta(2)-enoyl-CoA isomerase antibody
    • Delta(3) antibody
    • Delta(3) delta(2) enoyl CoA isomerase antibody
    • Diazepam-binding inhibitor-related protein 1 antibody
    • Dodecenoyl CoA isomerase antibody
    • Dodecenoyl-CoA isomerase antibody
    • DRS 1 antibody
    • DRS-1 antibody
    • DRS1 antibody
    • Eci2 antibody
    • ECI2_HUMAN antibody
    • Enoyl-CoA delta isomerase 2 antibody
    • HCA88 antibody
    • Hepatocellular carcinoma associated antigen 88 antibody
    • Hepatocellular carcinoma-associated antigen 88 antibody
    • mitochondrial antibody
    • pECI antibody
    • Peroxisomal 3 antibody
    • Peroxisomal 3,2-trans-enoyl-CoA isomerase antibody
    • Peroxisomal D3 D2 enoyl CoA isomerase antibody
    • Renal carcinoma antigen NY REN 1 antibody
    • Renal carcinoma antigen NY-REN-1 antibody
    see all

Images

  • All lanes : Anti-PECI/ECI2 antibody (ab235322) at 1/500 dilution

    Lane 1 : Rat heart tissue lysate
    Lane 2 : Mouse heart tissue lysate
    Lane 3 : Mouse liver tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 44 kDa

  • Paraffin-embedded human liver tissue stained for PECI/ECI2 using ab235322 at 1/100 dilution in immunohistochemical analysis.

References

ab235322 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235322.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up