Overview

  • Product name

  • Description

    Rabbit polyclonal to PEDF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human PEDF aa 20-418.
    Sequence:

    QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVR SSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIH GTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVL TGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVT KFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLT GSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKL SYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGA GTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP


    Database link: P36955

  • Positive control

    • WB: Human liver cell extracts. Mouse liver tissue lysate. IHC-P: Human stomach tissue. Human esophageal cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab180711 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 46 kDa.

Target

  • Function

    Neurotrophic protein; induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.
  • Tissue specificity

    Retinal pigment epithelial cells and blood plasma.
  • Sequence similarities

    Belongs to the serpin family.
  • Developmental stage

    Expressed in quiescent cells.
  • Domain

    The N-terminal (AA 44-121) exhibits neurite outgrowth-inducing activity. The C-terminal exposed loop (AA 382-418) is essential for serpin activity.
  • Post-translational
    modifications

    The N-terminus is blocked. Extracellular phosphorylation enhances antiangiogenic activity.
    N- and O-glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan.
  • Cellular localization

    Secreted. Melanosome. Enriched in stage I melanosomes.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cell proliferation-inducing gene 35 protein antibody
    • EPC 1 antibody
    • EPC-1 antibody
    • EPC1 antibody
    • OI12 antibody
    • OI6 antibody
    • PEDF antibody
    • PEDF_HUMAN antibody
    • PIG 35 antibody
    • PIG35 antibody
    • Pigment epithelium derived factor antibody
    • Pigment epithelium-derived factor antibody
    • Proliferation inducing protein 35 antibody
    • Serine (or cysteine) proteinase inhibitor antibody
    • serine (or cysteine) proteinase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 antibody
    • Serpin F1 antibody
    • Serpin family F member 1 antibody
    • Serpin peptidase inhibitor antibody
    • Serpin peptidase inhibitor clade F member 1 antibody
    • serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 antibody
    • SERPINF 1 antibody
    • Serpinf1 antibody
    see all

Images

  • Anti-PEDF antibody (ab180711) at 1/500 dilution + Human liver cell extracts

    Predicted band size: 46 kDa

  • Anti-PEDF antibody (ab180711) at 1/500 dilution + Mouse liver tissue lysate

    Predicted band size: 46 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human stomach tissue labeling PEDF with ab180711 at a dilution of 1/200.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human esophageal cancer tissue labeling PEDF with ab180711 at a dilution of 1/200.

References

This product has been referenced in:

  • Zhang Q  et al. A platform for assessing outer segment fate in primary human fetal RPE cultures. Exp Eye Res 178:212-222 (2019). Read more (PubMed: 30336126) »
  • Chen Y  et al. Photoreceptor degeneration in microphthalmia (Mitf) mice: partial rescue by pigment epithelium-derived factor. Dis Model Mech 12:N/A (2019). Read more (PubMed: 30651300) »
See all 6 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180711.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up