Overview

  • Product name

  • Description

    Rabbit polyclonal to Pellino-3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Pig
  • Immunogen

    Synthetic peptide corresponding to Human Pellino-3 aa 2-51 (N terminal).
    Sequence:

    VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG

  • Positive control

    • HepG2 cell lysate
  • General notes

    Previously labelled as PELI3.

Properties

Applications

Our Abpromise guarantee covers the use of ab76034 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 48 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Scaffold protein which probably links Toll-like receptors (TLRs) to basic cellular processes via its interaction with the complex containing IRAK kinases and TRAF6. Can activate AP1/JUN and ELK1. Not required for NF-kappa-B activation. Probably involved in innate immune response.
  • Tissue specificity

    Highly expressed in brain, heart and testis, and at lower level in kidney, liver, lung, placenta, small intestine, spleen and stomach. Isoform 1 is not expressed in lung.
  • Sequence similarities

    Belongs to the pellino family.
  • Information by UniProt
  • Database links

  • Alternative names

    • E3 ubiquitin protein ligase pellino homolog 3 antibody
    • MGC35521 antibody
    • PEL 13 antibody
    • Peli3 antibody
    • PELI3_HUMAN antibody
    • Pellino 3 antibody
    • Pellino 3 alpha antibody
    • Pellino E3 ubiquitin protein ligase family member 3 antibody
    • Pellino homolog 3 (Drosophila) antibody
    • Pellino-3 antibody
    • Protein pellino homolog 3 antibody
    see all

Images

  • Anti-Pellino-3 antibody (ab76034) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µg

    Secondary
    HRP-conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 48 kDa
    Observed band size: 40 kDa
    why is the actual band size different from the predicted?

References

ab76034 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab76034.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up