Anti-Penicillin-binding protein 4* antibody (ab229943)

Overview

  • Product name

    Anti-Penicillin-binding protein 4* antibody
  • Description

    Rabbit polyclonal to Penicillin-binding protein 4*
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity


    Predicted to work with: Bacillus subtilis
  • Immunogen

    Recombinant full length protein corresponding to Bacillus subtilis Penicillin-binding protein 4* aa 1-451. Strain 168.
    Sequence:

    MKQNKRKHLQTLFETLGEKHQFNGTVLAAEGGDILYHHSFGYAEMTEKRP LKTNSLFELASLSKPFTALGIILLEEKGILGYEDKVDRWLPGFPYQGVTI RHLLNHTSGLPDYMGWFFANWDSHKIAVNQDIVDMLMNEGLSGYFEPNEG WMYSNTGYVLLAVIIEKASGMSYADFIKTSIFLPAGMNETRVYNRRLSPE RIDHYAYGYVYDVHSETYVLPDELEETNYVVYLDGIQGDGTVNSVTSDLF RFDQALYQDDFISKASKESAFSPVRLNNGETIDYGFGWVLQNSPEKGRIV SHSGGWPGYSTMMIRYIDHRKTLIYLSNKEEDTEYEQAILKAAEHILFGQ PYDVPERPADKKKKAIDTAIYSRYVGSYLLQDGTAAQVTTENERLYLEIA GQLRLELFPSSETRFFLRALSVEVEFTLGEDAAKSFILYEDGSEEEAVRT K


    Database link: P32959

  • Positive control

    • WB: Penicillin-binding protein 4* recombinant protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab229943 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 51 kDa.

Target

  • Relevance

    Function: Probably involved in peptidoglycan modification during cortex synthesis.
  • Cellular localization

    Cell Membrane
  • Database links

    • Alternative names

      • PBP 4* antibody
      • PBP 4A antibody
      • pbpE antibody
      • Penicillin-binding protein E antibody

    References

    ab229943 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab229943.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up