Overview

  • Product name

  • Description

    Rabbit polyclonal to PER2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PER2 aa 700-900.
    Sequence:

    SLDCLAGPALACGLSQEKEPFKKLGLTKEVLAAHTQKEEQSFLQKFKEIR KLSIFQSHCHYYLQERSKGQPSERTAPGLRNTSGIDSPWKKTGKNRKLKS KRVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQSSCPAVPFPAP VPAAYSLPVFPAPGTVAAPPAPPHASFTVPAVPVDLQHQFAVQPPPFPAP L


    Database link: O15055-1

  • Positive control

    • Human testis lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab208163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 µg/ml. Predicted molecular weight: 137 kDa.

Target

  • Function

    Component of the circadian clock mechanism which is essential for generating circadian rhythms. Negative element in the circadian transcriptional loop. Influences clock function by interacting with other circadian regulatory proteins and transporting them to the nucleus. Negatively regulates CLOCK
    NPAS2-BMAL1
    BMAL2-induced transactivation.
  • Tissue specificity

    Widely expressed. Found in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. High levels in skeletal muscle and pancreas. Low level in lung.
  • Involvement in disease

    Defects in PER2 are a cause of familial advanced sleep-phase syndrome (FASPS) [MIM:604348]. FASPS is characterized by very early sleep onset and offset. Individuals are 'morning larks' with a 4 hours advance of the sleep, temperature and melatonin rhythms.
  • Sequence similarities

    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 2 PAS (PER-ARNT-SIM) domains.
  • Post-translational
    modifications

    Phosphorylated by CSNK1E and CSNK1D. Phosphorylation results in PER2 protein degradation.
  • Cellular localization

    Nucleus. Cytoplasm. Mainly nuclear. Nucleocytoplasmic shuttling is effected by interaction with other circadian core oscillator proteins and/or by phosphorylation. Retention of PER1 in the cytoplasm occurs through PER1-PER2 heterodimer formation or by interaction with CSNK1E and/or phosphorylation which appears to mask the PER nuclear localization signal. Also translocated to the nucleus by CRY1 or CRY2.
  • Information by UniProt
  • Database links

  • Alternative names

    • Circadian clock protein PERIOD 2 antibody
    • FASPS antibody
    • FASPS1 antibody
    • hPER 2 antibody
    • hPER2 antibody
    • KIAA0347 antibody
    • OTTHUMP00000164476 antibody
    • PER 2 antibody
    • PER2 antibody
    • PER2_HUMAN antibody
    • Period 2 antibody
    • Period 2 isoform 1 antibody
    • Period circadian clock 2 antibody
    • Period circadian protein 2 antibody
    • Period circadian protein homolog 2 antibody
    • Period homolog 2 (Drosophila) antibody
    • Period homolog 2 antibody
    • Period, Drosophila, homolog of, 2 antibody
    • Period2 antibody
    see all

Images

  • Anti-PER2 antibody (ab208163) at 2 µg/ml + Human testis lysate

    Predicted band size: 137 kDa

References

This product has been referenced in:

  • Xiong H  et al. Loss of the clock gene PER2 is associated with cancer development and altered expression of important tumor-related genes in oral cancer. Int J Oncol 52:279-287 (2018). Read more (PubMed: 29115399) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up