Overview

  • Product name

    Anti-PER3 antibody [4B9D7]
    See all PER3 primary antibodies
  • Description

    Mouse monoclonal [4B9D7] to PER3
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IF, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PER3 aa 723-954. (Purified from E.coli).
    Sequence:

    DSTSKQTRSAGCRKGKHKRKKLPEPPDSSSSNTGSGPRRGAHQNAQPCCP SAASSPHTSSPTFPPAAMVPSQAPYLVPAFPLPAATSPGREYAAPGTAPE GLHGLPLSEGLQPYPAFPFPYLDTFMTVFLPDPPVCPLLSPSFLPCPFLG ATASSAISPSMSSAMSPTLDPPPSVTSQRREEEKWEAQSEGHPFITSRSS SPLQLNLLQEEMPRPSESPDQMRRNTCPQTEY


    Database link: P56645

  • Positive control

    • Human PER3 (aa723-954) recombinant protein; PER3 (aa723-954)-hIgGFc transfected HEK293 cell lysate; HeLa cells; Human ovarian cancer and rectum cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab201940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 132 kDa.
ICC/IF 1/200 - 1/1000.
Flow Cyt 1/200 - 1/400.

ab170192 - Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Component of the circadian clock mechanism which is essential for generating circadian rhythms. Can bind heme.
  • Sequence similarities

    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 2 PAS (PER-ARNT-SIM) domains.
  • Post-translational
    modifications

    Phosphorylation appears to require association with PER1 and translocation to the nucleus.
    Ubiquitinated.
  • Cellular localization

    Cytoplasm. Nucleus. Mainly cytoplasmic. Translocates to the nucleus through binding PER1, PER2, CRY1 or CRY2, but not TIMELESS.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2810049O06Rik antibody
    • Cell growth inhibiting gene 13 protein antibody
    • Cell growth-inhibiting gene 13 protein antibody
    • Circadian clock protein PERIOD 3 antibody
    • GIG13 antibody
    • gPER3 antibody
    • Growth inhibiting protein 13 antibody
    • HGNC:8847 antibody
    • hPER3 antibody
    • mPer3 antibody
    • Per3 antibody
    • PER3_HUMAN antibody
    • Period 3 antibody
    • Period circadian clock 3 antibody
    • Period circadian protein 3 antibody
    • Period circadian protein homolog 3 antibody
    • Period homolog 3 (Drosophila) antibody
    • Period homolog 3 antibody
    • Period homolog 3, Drosophila antibody
    • Period3 antibody
    see all

Images

  • Anti-PER3 antibody [4B9D7] (ab201940) at 1/500 dilution + Human PER3 (aa723-954) recombinant protein

    Predicted band size: 132 kDa



    Expected MWt is 50.7 kDa.

  • All lanes : Anti-PER3 antibody [4B9D7] (ab201940) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : PER3 (aa723-954)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 132 kDa



    (Expected MW is 50.7 kDa)

  • Immunofluorescent analysis of HeLa cells labeling PER3 with ab201940 at 1/200 dilution. Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.

  • Flow cytometric analysis of HeLa cells labeling PER3 with ab201940 at 1/200 dilution (green) compared to a negative control (red).

  • Immunohistochemical analysis of paraffin-embedded Human ovarian cancer tissue labeling PER3 with ab201940 at 1/200 dilution, with DAB staining.

  • Immunohistochemical analysis of paraffin-embedded Human rectum cancer tissue labeling PER3 with ab201940 at 1/200 dilution, with DAB staining.

References

This product has been referenced in:

  • Knarr M  et al. miR-181a modulates circadian rhythm in immortalized bone marrow and adipose derived stromal cells and promotes differentiation through the regulation of PER3. Sci Rep 9:307 (2019). Read more (PubMed: 30670712) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up