Overview

  • Product name

  • Description

    Rabbit polyclonal to PER3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human PER3 aa 1-131.
    Sequence:

    MPRGEAPGPGRRGAKDEALGEESGERWSPEFHLQRKLADSSHSEQQDRNR VSEELIMVVQEMKKYFPSERRNKPSTLDALNYALRCVHSVQANSEFFQIL SQNGAPQADVSMYSLEELATIASEHTSKNTD


    Database link: P56645

  • Positive control

    • WB: HeLa whole cell lysate (ab150035); mouse skeletal muscle tissue lysate. IHC: Human ovarian cancer and colon cancer tissue lysate. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224594 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/5000. Detects a band of approximately 132 kDa (predicted molecular weight: 132 kDa).

Target

  • Function

    Component of the circadian clock mechanism which is essential for generating circadian rhythms. Can bind heme.
  • Sequence similarities

    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 2 PAS (PER-ARNT-SIM) domains.
  • Post-translational
    modifications

    Phosphorylation appears to require association with PER1 and translocation to the nucleus.
    Ubiquitinated.
  • Cellular localization

    Cytoplasm. Nucleus. Mainly cytoplasmic. Translocates to the nucleus through binding PER1, PER2, CRY1 or CRY2, but not TIMELESS.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2810049O06Rik antibody
    • Cell growth inhibiting gene 13 protein antibody
    • Cell growth-inhibiting gene 13 protein antibody
    • Circadian clock protein PERIOD 3 antibody
    • GIG13 antibody
    • gPER3 antibody
    • Growth inhibiting protein 13 antibody
    • HGNC:8847 antibody
    • hPER3 antibody
    • mPer3 antibody
    • Per3 antibody
    • PER3_HUMAN antibody
    • Period 3 antibody
    • Period circadian clock 3 antibody
    • Period circadian protein 3 antibody
    • Period circadian protein homolog 3 antibody
    • Period homolog 3 (Drosophila) antibody
    • Period homolog 3 antibody
    • Period homolog 3, Drosophila antibody
    • Period3 antibody
    see all

Images

  • All lanes : Anti-PER3 antibody (ab224594) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : Mouse skeletal tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 132 kDa
    Observed band size: 132 kDa

  • Paraffin-embedded human ovarian cancer tissue stained for PER3 using ab224594 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon cancer tissue stained for PER3 using ab224594 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for PER3 (green) using ab224594 at 1/100 dilution in ICC/IF.

References

ab224594 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224594.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up