Anti-Pericentrin 1/FROUNT antibody (ab176801)

Overview

  • Product name
    Anti-Pericentrin 1/FROUNT antibody
    See all Pericentrin 1/FROUNT primary antibodies
  • Description
    Rabbit polyclonal to Pericentrin 1/FROUNT
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human Pericentrin 1/FROUNT aa 1-50. The exact sequence is proprietary. (NP_079120.1).
    Sequence:

    MEELDGEPTVTLIPGVNSKKNQMYFDWGPGEMLVCETSFNKKEKSEMVPS


    Database link: Q9BW27

  • Positive control
    • 293T, HeLa, Jurkat, TCMK-1 and NIH 3T3 whole cell lysates.
  • General notes

    Protein previously labeled as Pericentrin 1.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab176801 was affinity purified using an epitope specific to Pericentrin 1 immobilized on solid support.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab176801 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 75 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function
    Essential component of the nuclear pore complex (NPC) that seems to be required for NPC assembly and maintenance. As part of the NPC Nup107-160 subcomplex plays a role in RNA export and in tethering NUP98/Nup98 and NUP153 to the nucleus. The Nup107-160 complex seems to be required for spindle assembly during mitosis. NUP85 is required for membrane clustering of CCL2-activated CCR2. Seems to be involved in CCR2-mediated chemotaxis of monocytes and may link activated CCR2 to the phosphatidyl-inositol 3-kinase-Rac-lammellipodium protrusion cascade.
  • Sequence similarities
    Belongs to the nucleoporin Nup85 family.
  • Cellular localization
    Nucleus > nuclear pore complex. Chromosome > centromere > kinetochore. Cytoplasm > cytoskeleton > spindle. Cytoplasm. Nucleus membrane. During mitosis, localizes to the kinetochores and spindle poles. Upon CCl2 stimulation translocates from the cytoplasm to the membrane and colocalizes with CCR2 at the front of migrating cells.
  • Information by UniProt
  • Database links
  • Alternative names
    • 85 kDa nucleoporin antibody
    • FLJ12549 antibody
    • FROUNT antibody
    • Frount protein antibody
    • Nuclear pore complex protein nucleoporin 85 kDa antibody
    • nuclear pore complex protein nucleoporin Nup75 antibody
    • Nuclear pore complex protein Nup85 antibody
    • Nucleoporin 85 antibody
    • Nucleoporin 85kDa antibody
    • Nucleoporin nucleoporin 85kDa antibody
    • Nucleoporin Nup75 antibody
    • Nucleoporin NUP85 antibody
    • nucleoporin, 75-KD antibody
    • Nucleoporin85 antibody
    • Nup 75 antibody
    • NUP 85 antibody
    • Nup75 antibody
    • nup85 antibody
    • NUP85_HUMAN antibody
    • PCN antibody
    • PCNT 1 antibody
    • PCNT antibody
    • PCNT, formerly antibody
    • PCNT1 antibody
    • Pericentrin antibody
    • Pericentrin, formerly antibody
    • Pericentrin-1 antibody
    • Pericentrin1 antibody
    see all

Images

  • All lanes : Anti-Pericentrin 1/FROUNT antibody (ab176801) at 0.1 µg/ml

    Lane 1 : 293T whole cell lysate
    Lane 2 : HeLa whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK-1 whole cell lysate
    Lane 5 : NIH 3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 75 kDa


    Exposure time: 3 minutes
  • Detection of Pericentrin 1 in Immunoprecipitates of 293T whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176801 at 6 µg/mg lysate for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.

    Detection: Chemiluminescence with an exposure time of 10 seconds..

References

ab176801 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176801.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up