Overview

  • Product name

    Anti-Pericentrin 1/FROUNT antibody
    See all Pericentrin 1/FROUNT primary antibodies
  • Description

    Rabbit polyclonal to Pericentrin 1/FROUNT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Cow, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse Pericentrin 1/FROUNT aa 418-653. N-terminal tags. Expressed in E.coli.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-QLGVDYFDCPELG RVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVKSICKILAMKAVRNN RLGSALSWSIRAKDAAFATLVSDRFLRDYCERGCFSDLDLIDNLGSAMML SDRLTFLGKYREFHRLYGEKRFGDAASLLLSLMTSQIAPRSFWMTLLTDA LPLLEQKQVIFSAEQTYELMRCLEDLASGRPECGEPDAQRLQDDDIETTK VEMLRLALARNLARAIIREGSL


    Database link: Q8R480

  • Positive control

    • IHC-P: Mouse testis, stomach, heart and uterus tissues. WB: Recombinant human Pericentrin 1/FROUNT protein; Mouse lung liver and heart tissues.
  • General notes

    Protein previously labeled as Pericentrin 1.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.

Target

  • Function

    Essential component of the nuclear pore complex (NPC) that seems to be required for NPC assembly and maintenance. As part of the NPC Nup107-160 subcomplex plays a role in RNA export and in tethering NUP98/Nup98 and NUP153 to the nucleus. The Nup107-160 complex seems to be required for spindle assembly during mitosis. NUP85 is required for membrane clustering of CCL2-activated CCR2. Seems to be involved in CCR2-mediated chemotaxis of monocytes and may link activated CCR2 to the phosphatidyl-inositol 3-kinase-Rac-lammellipodium protrusion cascade.
  • Sequence similarities

    Belongs to the nucleoporin Nup85 family.
  • Cellular localization

    Nucleus > nuclear pore complex. Chromosome > centromere > kinetochore. Cytoplasm > cytoskeleton > spindle. Cytoplasm. Nucleus membrane. During mitosis, localizes to the kinetochores and spindle poles. Upon CCl2 stimulation translocates from the cytoplasm to the membrane and colocalizes with CCR2 at the front of migrating cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • 85 kDa nucleoporin antibody
    • FLJ12549 antibody
    • FROUNT antibody
    • Frount protein antibody
    • Nuclear pore complex protein nucleoporin 85 kDa antibody
    • nuclear pore complex protein nucleoporin Nup75 antibody
    • Nuclear pore complex protein Nup85 antibody
    • Nucleoporin 85 antibody
    • Nucleoporin 85kDa antibody
    • Nucleoporin nucleoporin 85kDa antibody
    • Nucleoporin Nup75 antibody
    • Nucleoporin NUP85 antibody
    • nucleoporin, 75-KD antibody
    • Nucleoporin85 antibody
    • Nup 75 antibody
    • NUP 85 antibody
    • Nup75 antibody
    • nup85 antibody
    • NUP85_HUMAN antibody
    • PCN antibody
    • PCNT 1 antibody
    • PCNT antibody
    • PCNT, formerly antibody
    • PCNT1 antibody
    • Pericentrin antibody
    • Pericentrin, formerly antibody
    • Pericentrin-1 antibody
    • Pericentrin1 antibody
    see all

Images

  • All lanes : Anti-Pericentrin 1/FROUNT antibody (ab231958) at 2 µg/ml

    Lane 1 : Mouse lung tissue lysate
    Lane 2 : Mouse liver tissue lysate
    Lane 3 : Mouse heart tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded mouse uterus tissue stained for Pericentrin 1/FROUNT using ab231958 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse heart tissue stained for Pericentrin 1/FROUNT using ab231958 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse stomach tissue stained for Pericentrin 1/FROUNT using ab231958 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse testis tissue stained for Pericentrin 1/FROUNT using ab231958 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Pericentrin 1/FROUNT antibody (ab231958) at 2 µg/ml + Recombinant human Pericentrin 1/FROUNT protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

References

ab231958 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231958.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up