Anti-Pericentrin antibody (ab224423)

Rabbit polyclonal Pericentrin antibody. Validated in IHC, ICC/IF and tested in Human. Immunogen corresponding to recombinant fragment.

Overview

  • Product name

  • Description

    Rabbit polyclonal to Pericentrin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Pericentrin aa 2218-2346.
    Sequence:

    MLDLSSWSSPEVLRKDWTLEPWPSLPVTPHSGALSLCSADTSLGDRADTS LPQTQGPGLLCSPGVSAAALALQWAESPPADDHHVQRTAVEKDVEDFITT SFDSQETLSSPPPGLEGKADRSEKSDGSG


    Database link: O95613

  • Positive control

    • IHC-P: Human placenta tissue. ICC/IF: U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224423 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Integral component of the filamentous matrix of the centrosome involved in the initial establishment of organized microtubule arrays in both mitosis and meiosis. Plays a role, together with DISC1, in the microtubule network formation. Is an integral component of the pericentriolar material (PCM). May play an important role in preventing premature centrosome splitting during interphase by inhibiting NEK2 kinase activity at the centrosome.
  • Tissue specificity

    Expressed in all tissues tested, including placenta, liver, kidney and thymus.
  • Involvement in disease

    Microcephalic osteodysplastic primordial dwarfism 2
  • Domain

    Composed of a coiled-coil central region flanked by non-helical N- and C-terminals.
  • Cellular localization

    Cytoplasm > cytoskeleton > microtubule organizing center > centrosome. Centrosomal at all stages of the cell cycle. Remains associated with centrosomes following microtubule depolymerization. Colocalized with DISC1 at the centrosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • Centrosome Marker antibody
    • Ken antibody
    • Kendrin antibody
    • KIAA0402 antibody
    • MOPD2 antibody
    • PCN antibody
    • PCNT 2 antibody
    • PCNT antibody
    • PCNT B antibody
    • PCNT_HUMAN antibody
    • PCNT1 antibody
    • PCNT2 antibody
    • PCNTB antibody
    • PCTN2 antibody
    • Pericentrin 1 antibody
    • Pericentrin 2 antibody
    • Pericentrin 380 antibody
    • Pericentrin antibody
    • Pericentrin B antibody
    • Pericentrin-B antibody
    • SCKL4 antibody
    see all

Images

  • Paraffin-embedded human placenta tissue stained for Pericentrin using ab224423 at 1/200 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for Pericentrin (green) using ab224423 at 4 µg/ml in ICC/IF.

References

ab224423 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224423.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up