Overview

  • Product name

    Anti-Perilipin 3/TIP47 antibody
    See all Perilipin 3/TIP47 primary antibodies
  • Description

    Rabbit polyclonal to Perilipin 3/TIP47
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Perilipin 3/TIP47 aa 254-378.
    Sequence:

    SLGKLRATKQRAQEALLQLSQALSLMETVKQGVDQKLVEGQEKLHQMWLS WNQKQLQGPEKEPPKPEQVESRALTMFRDIAQQLQATCTSLGSSIQGLPT NVKDQVQQARRQVEDLQATFSSIHS


    Database link: O60664

  • Positive control

    • WB: U-86 MG cell lysate. IHC-P: Human small intestine tissue. ICC/IF: A431 cells.
  • General notes

    Previously labelled as Perilipin 3. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224344 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 47 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Required for the transport of mannose 6-phosphate receptors (MPR) from endosomes to the trans-Golgi network.
  • Sequence similarities

    Belongs to the perilipin family.
  • Cellular localization

    Cytoplasm. Endosome membrane. Lipid droplet. Membrane associated on endosomes. Detected in the envelope and the core of lipid bodies and in lipid sails.
  • Information by UniProt
  • Database links

  • Alternative names

    • 47 kDa mannose 6-phosphate receptor-binding protein antibody
    • 47 kDa MPR binding protein antibody
    • 47 kDa MPR-binding protein antibody
    • Cargo selection protein TIP47 antibody
    • M6PRBP 1 antibody
    • M6PRBP1 antibody
    • Mannose 6 phosphate receptor binding protein 1 antibody
    • Mannose-6-phosphate receptor-binding protein 1 antibody
    • MGC11117 antibody
    • MGC2012 antibody
    • MPR binding protein 47 kDa antibody
    • Perilipin 3 antibody
    • Perilipin-3 antibody
    • Perilipin3 antibody
    • Placental protein 17 antibody
    • PLIN3 antibody
    • PLIN3_HUMAN antibody
    • pp17 antibody
    • Tail interacting protein 47 kD antibody
    • TIP47 antibody
    see all

Images

  • Anti-Perilipin 3/TIP47 antibody (ab224344) at 1/100 dilution + U-87 MG (human glioblastoma-astrocytoma epithelial cell line) cell lysate

    Predicted band size: 47 kDa

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for Perilipin 3/TIP47 (green) using ab224344 (4 µg/ml) in ICC/IF.

  • Paraffin-embedded human small intestine tissue stained for Perilipin 3/TIP47 with ab224344 (1/200) in immunohistochemical analysis.

References

ab224344 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224344.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up