Overview

  • Product name

  • Description

    Rabbit polyclonal to Periostin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Rat Periostin aa 24-173. N-terminal tag. Expressed in E.coli.
    Sequence:

    NSYYDKVLAHSRIRGRDQGPNVCALQQILGTKKKYFSSCKNWYQGAICGK KTTVLYECCPGYMRMEGMKGCPAVMPIDHVYGTLGIVGATTTQHYSDVSK LREEIEGKGSYTYFAPSNEAWDNLDSDIRRGLENNVNVELLNALHSHMVN


    Database link: D3ZAF5

  • Positive control

    • WB: Recombinant rat Periostin protein; Rat lung lysate and serum. IHC-P: Rat liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231130 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 93 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Binds to heparin. Induces cell attachment and spreading and plays a role in cell adhesion. May play a role in extracellular matrix mineralization.
  • Tissue specificity

    Widely expressed with highest levels in aorta, stomach, lower gastrointestinal tract, placenta, uterus and breast. Up-regulated in epithelial ovarian tumors. Not expressed in normal ovaries. Also highly expressed at the tumor periphery of lung carcinoma tissue but not within the tumor. Overexpressed in breast cancers.
  • Sequence similarities

    Contains 1 EMI domain.
    Contains 4 FAS1 domains.
  • Post-translational
    modifications

    Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Fasciclin-I like antibody
    • MGC119510 antibody
    • MGC119511 antibody
    • OSF 2 antibody
    • OSF-2 antibody
    • OSF2 antibody
    • Osteoblast specific factor 2 (fasciclin I like) antibody
    • Osteoblast specific factor 2 antibody
    • Osteoblast specific factor antibody
    • Osteoblast-specific factor 2 antibody
    • PDLPOSTN antibody
    • Periodontal ligament specific periostin antibody
    • Periostin antibody
    • Periostin isoform thy2 antibody
    • Periostin isoform thy4 antibody
    • Periostin isoform thy6 antibody
    • Periostin isoform thy8 antibody
    • Periostin osteoblast specific factor antibody
    • PN antibody
    • POSTN antibody
    • POSTN_HUMAN antibody
    • RP11 412K4.1 antibody
    see all

Images

  • Anti-Periostin antibody (ab231130) at 2 µg/ml + Recombinant rat Periostin protein.

    Developed using the ECL technique.

    Predicted band size: 93 kDa

  • Anti-Periostin antibody (ab231130) at 2 µg/ml + Rat lung tissue lysate.

    Developed using the ECL technique.

    Predicted band size: 93 kDa

  • Anti-Periostin antibody (ab231130) at 2 µg/ml + Rat serum.

    Developed using the ECL technique.

    Predicted band size: 93 kDa

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for Periostin using ab231130 at 20 μg/ml in immunohistochemical analysis.

References

ab231130 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231130.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up