Overview

  • Product name

  • Description

    Rabbit polyclonal to Periplakin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Periplakin aa 1439-1716. N-terminal tags. Expressed in E.coli.
    Sequence:

    EKVTHTQKVVLQQDPQQAREHALLRLQLEEEQHRRQLLEGELETLRRKLA ALEKAEVKEKVVLSESVQVEKGDTEQEIQRLKSSLEEESRSKRELDVEVS RLEARLSELEFHNSKSSKELDFLREENHKLQLERQNLQLETRRLQSEINM AATETRDLRNMTVADSGTNHDSRLWSLERELDDLKRLSKDKDLEIDELQK RLGSVAVKREQRENHLRRSIVVIHPDTGRELSPEEAHRAGLIDWNMFVKL RSQECDWEEISVKGPNGESSVIHDRKSG


    Database link: O60437

  • Positive control

    • IHC-P: Human brain tissue. WB: Recombinant human Periplakin protein; Pig skin lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233128 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Component of the cornified envelope of keratinocytes. May link the cornified envelope to desmosomes and intermediate filaments. May act as a localization signal in PKB/AKT-mediated signaling.
  • Tissue specificity

    Expressed in stratified squamous epithelia and in some other epithelia.
  • Sequence similarities

    Belongs to the plakin or cytolinker family.
    Contains 2 plectin repeats.
    Contains 4 spectrin repeats.
  • Cellular localization

    Cell junction > desmosome. Cytoplasm > cytoskeleton. Cell membrane. Nucleus. Mitochondrion. Associated with desmosomes and intermediate filaments.
  • Information by UniProt
  • Database links

  • Alternative names

    • 190 kDa paraneoplastic pemphigus antigen antibody
    • 195 kDa cornified envelope precursor antibody
    • 195 kDa cornified envelope precursor protein antibody
    • AW553870 antibody
    • KIAA0568 antibody
    • MGC134872 antibody
    • PEPL_HUMAN antibody
    • Periplakin antibody
    • ppl antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human brain tissue stained for periplakin using ab233128 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-Periplakin antibody (ab233128) at 5 µg/ml + Pig skin tissue lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml
  • Anti-Periplakin antibody (ab233128) at 2 µg/ml + Recombinant human Periplakin protein

References

ab233128 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233128.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up