Overview

  • Product name

    Anti-Peroxiredoxin 2/PRP antibody
    See all Peroxiredoxin 2/PRP primary antibodies
  • Description

    Rabbit polyclonal to Peroxiredoxin 2/PRP
  • Host species

    Rabbit
  • Specificity

    ab218161 may have a minor secondary cross-reactivity to related protein Peroxiredoxin 1 due to a 71% non-sequential sequence similarity over the immunogen range.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human Peroxiredoxin 2/PRP aa 150-197 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    RSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKH


    Database link: P32119

  • Positive control

    • Rat brain lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab218161 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Detects a band of approximately 22 kDa (predicted molecular weight: 22 kDa).

Target

  • Function

    Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).
  • Sequence similarities

    Belongs to the ahpC/TSA family.
    Contains 1 thioredoxin domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Epididymis secretory sperm binding protein Li 2a antibody
    • HEL S 2a antibody
    • MGC4104 antibody
    • Natural killer cell enhancing factor B antibody
    • Natural killer cell-enhancing factor B antibody
    • Natural Killer Enhancing Factor B antibody
    • NKEF B antibody
    • NKEF-B antibody
    • NKEFB antibody
    • Peroxiredoxin 2 antibody
    • Peroxiredoxin-2 antibody
    • PRDX 2 antibody
    • PRDX2 antibody
    • PRDX2_HUMAN antibody
    • PrP antibody
    • PRX2 antibody
    • PRXII antibody
    • PTX1 antibody
    • TDPX1 antibody
    • Thiol Specific Antioxidant 1 antibody
    • Thiol specific antioxidant protein antibody
    • Thiol-specific antioxidant protein antibody
    • Thioredoxin Dependent Peroxide Reductase 1 antibody
    • Thioredoxin peroxidase 1 antibody
    • Thioredoxin-dependent peroxide reductase 1 antibody
    • Torin antibody
    • TPX1 antibody
    • TSA antibody
    see all

Images

  • All lanes : Anti-Peroxiredoxin 2/PRP antibody (ab218161) at 1/200 dilution

    Lane 1 : Rat brain lysate
    Lane 2 : Rat heart lysate

    Secondary
    All lanes : Goat Anti-Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/3000 dilution

    Predicted band size: 22 kDa
    Observed band size: 22 kDa

References

ab218161 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218161.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up