Anti-Peroxiredoxin 2/PRP antibody (ab218161)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Peroxiredoxin 2/PRP antibody
See all Peroxiredoxin 2/PRP primary antibodies -
Description
Rabbit polyclonal to Peroxiredoxin 2/PRP -
Host species
Rabbit -
Specificity
ab218161 may have a minor secondary cross-reactivity to related protein Peroxiredoxin 1 due to a 71% non-sequential sequence similarity over the immunogen range. -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Rat
Predicted to work with: Mouse, Human -
Immunogen
Synthetic peptide within Human Peroxiredoxin 2/PRP aa 150-197 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:RSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKH
Database link: P32119 -
Positive control
- Rat brain lysate
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 1% BSA -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab218161 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/100 - 1/1000. Detects a band of approximately 22 kDa (predicted molecular weight: 22 kDa). |
Target
-
Function
Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). -
Sequence similarities
Belongs to the ahpC/TSA family.
Contains 1 thioredoxin domain. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 7001 Human
- Entrez Gene: 21672 Mouse
- Entrez Gene: 29338 Rat
- Omim: 600538 Human
- SwissProt: P32119 Human
- SwissProt: Q61171 Mouse
- SwissProt: P35704 Rat
- Unigene: 432121 Human
see all -
Alternative names
- Epididymis secretory sperm binding protein Li 2a antibody
- HEL S 2a antibody
- MGC4104 antibody
see all
Images
-
All lanes : Anti-Peroxiredoxin 2/PRP antibody (ab218161) at 1/200 dilution
Lane 1 : Rat brain lysate
Lane 2 : Rat heart lysate
Secondary
All lanes : Goat Anti-Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/3000 dilution
Predicted band size: 22 kDa
Observed band size: 22 kDa
Protocols
Datasheets and documents
References
ab218161 has not yet been referenced specifically in any publications.