Anti-Peroxiredoxin 2/PRP antibody (ab218161)

Submit a review Submit a question

Key features and details

  • Rabbit polyclonal to Peroxiredoxin 2/PRP
  • Suitable for: WB
  • Reacts with: Rat
  • Isotype: IgG

Overview

  • Product name

    Anti-Peroxiredoxin 2/PRP antibody
    See all Peroxiredoxin 2/PRP primary antibodies

  • Description

    Rabbit polyclonal to Peroxiredoxin 2/PRP

  • Host species

    Rabbit

  • Specificity

    ab218161 may have a minor secondary cross-reactivity to related protein Peroxiredoxin 1 due to a 71% non-sequential sequence similarity over the immunogen range.

  • Tested applications

    Suitable for: WBmore details

  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human

  • Immunogen

    Synthetic peptide within Human Peroxiredoxin 2/PRP aa 150-197 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    RSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKH


    Database link: P32119

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • Rat brain lysate

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

Applications

Our Abpromise guarantee covers the use of ab218161 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Detects a band of approximately 22 kDa (predicted molecular weight: 22 kDa).

Target

  • Function

    Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).

  • Sequence similarities

    Belongs to the ahpC/TSA family.
    Contains 1 thioredoxin domain.

  • Cellular localization

    Cytoplasm.
  • Information by UniProt

  • Database links

    see all

  • Alternative names

    • Epididymis secretory sperm binding protein Li 2a antibody
    • HEL S 2a antibody
    • MGC4104 antibody
    • Natural killer cell enhancing factor B antibody
    • Natural killer cell-enhancing factor B antibody
    • Natural Killer Enhancing Factor B antibody
    • NKEF B antibody
    • NKEF-B antibody
    • NKEFB antibody
    • Peroxiredoxin 2 antibody
    • Peroxiredoxin-2 antibody
    • PRDX 2 antibody
    • PRDX2 antibody
    • PRDX2_HUMAN antibody
    • PrP antibody
    • PRX2 antibody
    • PRXII antibody
    • PTX1 antibody
    • TDPX1 antibody
    • Thiol Specific Antioxidant 1 antibody
    • Thiol specific antioxidant protein antibody
    • Thiol-specific antioxidant protein antibody
    • Thioredoxin Dependent Peroxide Reductase 1 antibody
    • Thioredoxin peroxidase 1 antibody
    • Thioredoxin-dependent peroxide reductase 1 antibody
    • Torin antibody
    • TPX1 antibody
    • TSA antibody
    see all

Images

  • Western blot - Anti-Peroxiredoxin 2/PRP antibody (ab218161)
    Western blot - Anti-Peroxiredoxin 2/PRP antibody (ab218161)
    All lanes : Anti-Peroxiredoxin 2/PRP antibody (ab218161) at 1/200 dilution

    Lane 1 : Rat brain lysate
    Lane 2 : Rat heart lysate

    Secondary
    All lanes : Goat Anti-Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/3000 dilution

    Predicted band size: 22 kDa
    Observed band size: 22 kDa

References (0)

Publishing research using ab218161? Please let us know so that we can cite the reference in this datasheet.

ab218161 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab218161.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com