Overview

  • Product name

    Anti-Peroxiredoxin 3/PRDX3 antibody
    See all Peroxiredoxin 3/PRDX3 primary antibodies
  • Description

    Rabbit polyclonal to Peroxiredoxin 3/PRDX3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IF, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Peroxiredoxin 3/PRDX3 aa 63-256.
    Sequence:

    PAVTQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEI VAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLS DLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEET LRLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQKVNQ


    Database link: P30048

  • Positive control

    • WB: HeLa, HepG2 and MCF7 whole cell lysates; Mouse heart, liver, brain, lung, kidney and stomach lysates. IHC-P: Human lung cancer and renal tissues. ICC/IF: HepG2 cells. IP: HeLa whole cell lysate.
  • General notes

     This product was previously labelled as Peroxiredoxin 3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab222807 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 28 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.
IP 1/200 - 1/2000.

Target

  • Function

    Involved in redox regulation of the cell. Protects radical-sensitive enzymes from oxidative damage by a radical-generating system. Acts synergistically with MAP3K13 to regulate the activation of NF-kappa-B in the cytosol.
  • Sequence similarities

    Belongs to the ahpC/TSA family.
    Contains 1 thioredoxin domain.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • Antioxidant protein 1 antibody
    • AOP 1 antibody
    • AOP-1 antibody
    • AOP1 antibody
    • HBC189 antibody
    • MER5 antibody
    • MGC104387 antibody
    • MGC24293 antibody
    • mitochondrial antibody
    • peroxiredoxin 3 antibody
    • Peroxiredoxin III antibody
    • Peroxiredoxin-3 antibody
    • PRDX3 antibody
    • PRDX3_HUMAN antibody
    • PRO1748 antibody
    • Protein MER5 homolog antibody
    • PRX III antibody
    • Prx-III antibody
    • PRX3 antibody
    • SP 22 antibody
    • SP-22 antibody
    • SP22 antibody
    • Thioredoxin dependent peroxide reductase mitochondrial antibody
    • Thioredoxin-dependent peroxide reductase antibody
    see all

Images

  • All lanes : Anti-Peroxiredoxin 3/PRDX3 antibody (ab222807) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 3 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 4 : Mouse heart lysate
    Lane 5 : Mouse liver lysate
    Lane 6 : Mouse brain lysate
    Lane 7 : Mouse lung lysate
    Lane 8 : Mouse kidney lysate
    Lane 9 : Mouse stomach lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 28 kDa

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for Peroxiredoxin 3/PRDX3 (green) using ab222807 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human renal tissue stained for Peroxiredoxin 3/PRDX3 using ab222807 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung cancer tissue stained for Peroxiredoxin 3/PRDX3 using ab222807 at 1/100 dilution in immunohistochemical analysis.

  • Peroxiredoxin 3/PRDX3 was immunoprecipitated from HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate with ab222807 at 1/200 dilution. Western blot was performed from the immunoprecipitate using ab222807, followed by HRP-conjugated Protein G secondary antibody at 1/2000 dilution.

    Lane 1: Rabbit monoclonal IgG (1 µg) instead of ab222807 in Hela whole cell lysate.

    Lane 2: ab222807 IP in Hela whole cell lysate (500 µg).

    Lane 3: Hela whole cell lysate (10 µg) (Input).  

References

This product has been referenced in:

  • Wang L  et al. The association of plasma peroxiredoxin 3 with insulin in pregnant women. Biochem Biophys Res Commun 508:805-810 (2019). Read more (PubMed: 30528738) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222807.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up