Overview

  • Product name
    Anti-Peroxiredoxin 4 antibody
    See all Peroxiredoxin 4 primary antibodies
  • Description
    Rabbit polyclonal to Peroxiredoxin 4
  • Host species
    Rabbit
  • Specificity
    ab59542 reacts with Peroxiredoxin 4.
  • Tested applications
    Suitable for: WB, ELISA, IHC-Fr, IHC-P, ICC/IF, IPmore details
  • Species reactivity
    Reacts with: Rat, Human
    Predicted to work with: Mouse, Cow, Xenopus laevis, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human Peroxiredoxin 4 aa 65-83.
    Sequence:

    SRVSVADHSLHLSKAKISK

  • Positive control
    • Recombinant human Peroxiredoxin 4 protein (ab117192) can be used as a positive control in WB. Non-ciliated bronchiolar cells (Clara cells) in rat lung and sebaceous glands in rat skin.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.02% Thimerosal (merthiolate)
    Constituent: Whole serum
  • Purity
    Whole antiserum
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab59542 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/4000. Predicted molecular weight: 31 kDa.
ELISA 1/1000 - 1/4000.
IHC-Fr 1/500 - 1/1000.
IHC-P Use at an assay dependent concentration.
ICC/IF 1/50 - 1/100.
IP Use at an assay dependent concentration.

Target

  • Function
    Probably involved in redox regulation of the cell. Regulates the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation.
  • Sequence similarities
    Belongs to the ahpC/TSA family.
    Contains 1 thioredoxin domain.
  • Cellular localization
    Cytoplasm. Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Antioxidant enzyme 372 antibody
    • Antioxidant enzyme AOE372 antibody
    • AOE37 2 antibody
    • AOE37-2 antibody
    • AOE372 antibody
    • EC 1.11.1.15 antibody
    • Peroxiredoxin IV antibody
    • Peroxiredoxin-4 antibody
    • Peroxiredoxin4 antibody
    • PRDX 4 antibody
    • Prdx4 antibody
    • PRDX4_HUMAN antibody
    • PRX 4 antibody
    • Prx IV antibody
    • Prx-IV antibody
    • PRX4 antibody
    • PrxIV antibody
    • Thioredoxin dependent peroxide reductase A0372 antibody
    • Thioredoxin Peroxidase (Antioxidant Enzyme) antibody
    • Thioredoxin peroxidase antibody
    • Thioredoxin peroxidase AO372 antibody
    • Thioredoxin-dependent peroxide reductase A0372 antibody
    • TRANK antibody
    see all

Images

  • All lanes : Anti-Peroxiredoxin 4 antibody (ab59542) at 1 µg/ml

    Lane 1 : HeLa (Human epithelial carcinoma cell line) Whole Cell Lysate
    Lane 2 : Jurkat (Human T cell lymphoblast-like cell line) Whole Cell Lysate
    Lane 3 : HEK293 (Human embryonic kidney cell line) Whole Cell Lysate
    Lane 4 : Raji (Human Burkitt's lymphoma cell line) Whole Cell Lysate

    Lysates/proteins at 10 µg per lane.

    Secondary
    All lanes : Goat polyclonal Secondary Antibody to Rabbit IgG - H&L (HRP), pre-adsorbed at 1/3000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Predicted band size: 31 kDa
    Observed band size: 27 kDa
    why is the actual band size different from the predicted?
    Additional bands at: 74 kDa, 98 kDa. We are unsure as to the identity of these extra bands.


    Exposure time: 30 seconds


    The band observed at 27 kDa could potentially be a cleaved form of Peroxiredoxin 4 due to the presence of a 39 amino acid signal peptide.
  • Peroxiredoxin 4 was immunoprecipitated using 0.5mg Hek293 whole cell extract, 5µl of Rabbit polyclonal to Peroxiredoxin 4 sera and 50µl of protein G magnetic beads (+). No antibody was added to the control (-).

    The antibody was incubated under agitation with Protein G beads for 10min, Hek293 whole cell extract lysate diluted in RIPA buffer was added to each sample and incubated for a further 10min under agitation.

    Proteins were eluted by addition of 40µl SDS loading buffer and incubated for 10min at 70°C; 10µl of each sample was separated on a SDS PAGE gel, transferred to a nitrocellulose membrane, blocked with 5% BSA and probed with ab59542.

    Secondary: Mouse monoclonal [SB62a] Secondary Antibody to Rabbit IgG light chain (HRP) (ab99697).

    Band: 27kDa; Peroxiredoxin 4, non specific - as present in control (lane 2); 27kDa: We are confident this was due to slight lane contamination and the band seen in the IP lane is our target of interest.

  • ab59542 at 1/100 dilution staining Peroxiredoxin 4 in sebaceous glands in rat skin by Immunohistochemistry. Secondary antibody Jackson biotinylated Donkey anti-rabbit (1/2000) followed by Vector ABC kit and visualised with DAB substrate.
  • ab59542 at 1/100 dilution staining Peroxiredoxin 4 in Non-ciliated bronchiolar cells (Clara cells) in rat lung by Immunofluorescence. Secondary antibody Jackson Cy3 (1/200).

References

This product has been referenced in:
  • Zhang H  et al. Differential expression of peroxiredoxin 3 in laryngeal squamous cell carcinoma. Oncotarget 8:3471-3480 (2017). WB . Read more (PubMed: 27966448) »
  • Jayaram DT  et al. Nanoparticle-induced oxidation of corona proteins initiates an oxidative stress response in cells. Nanoscale 9:7595-7601 (2017). Read more (PubMed: 28537609) »
See all 12 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Answer

Thank you for contacting us.

The source of ab16943 informed us that theimmunogen used for this antibody isa recombinant human fragment protein (without secretion leader sequence) purified from E.coli. Only the region “WETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAK” is common to your sequence. Furthermore, the epitope has not been mapped for this antibody, therefore we cannot determineifab16943 candetect the antigen you mentioned.

We have several anti-Peroxiredoxin 4 antibodies in our catalogue and one of themseems to be suitable for thedetectionof the sequence you sent. The reference of this antibody is ab59542, https://www.abcam.com/ab59542 (immunogen SRVSVADHSLHLSKAKISK).

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Answer

I received some useful information from the laboratory that developed this antibody: "In human lung we see two very clean bands, one around 29kD and the other around 60kD. This protein is reported as being synthesised as a 31kD protein and a signal peptide cleaved prior to secretion resulting in a 27kd protein, a couple of papers have shown these two bands. This protein does form a dimer and under non reducing conditions the two proteins 29 and 60kd are clearly visible. This is shown very clearly in a recently published paper (http://www.biochemj.org/bj/imps/abs/BJ20071428.htm). We would suggest the customer have a read of this paper. We would send an image of a blot but one of our researchers wishes to use it in a publication shortly. We see the two bands 29 and 60kD even on reducing gel/blots which probably reflects incomplete reduction. The blots in the paper above are very similar to what we achieve." They also suggest something you have no doubt already done: Pubmed search for Peroxiredoxin IV (not 4) in the title. I hope the above information is useful. If you have any questions, please do not hesitate to contact us.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up