Anti-Peroxiredoxin Asp f3 antibody (ab225925)

Overview

  • Product name

    Anti-Peroxiredoxin Asp f3 antibody
  • Description

    Rabbit polyclonal to Peroxiredoxin Asp f3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Species independent
  • Immunogen

    Recombinant full length protein corresponding to Peroxiredoxin Asp f3 aa 1-168. Neosartorya fumigata. Immunogen has 6 His-SUMO tag at N-terminus.
    Sequence:

    MSGLKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVIL FALPGAFTPVCSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGK ANQVTGDDILFLSDPDARFSKSIGWADEEGRTKRYALVIDHGKITYAALE PAKNHLEFSSAETVLKHL


    Database link: O43099

  • Positive control

    • WB: Recombinant protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab225925 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.

Images

  • All lanes : Anti-Peroxiredoxin Asp f3 antibody (ab225925) at 1/500 dilution

    Lane 1 : Recombinant protein 100 ng
    Lane 2 : Recombinant protein 50 ng
    Lane 3 : Recombinant protein 25 ng
    Lane 4 : Recombinant protein 12.5 ng

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Developed using the ECL technique.

    Observed band size: 35 kDa
    why is the actual band size different from the predicted?



    The recombinant protein used in this western blot is tagged with 6 His-SUMO tag at N-terminus.
    Expected molecular weight of tag: 16kDa
    Expected molecular weight of Peroxiredoxin Asp f3: 19kDa

References

ab225925 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225925.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up