Overview

  • Product name

    Anti-Pertussis toxin antibody
  • Description

    Rabbit polyclonal to Pertussis toxin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Bordetella pertussis
  • Immunogen

    Recombinant full length protein corresponding to Bordetella pertussis Pertussis toxin aa 35-269.
    Sequence:

    DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAF VSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGA ASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHN GITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGA CMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF


    Database link: P04977

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab193494 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 30 kDa.
ELISA Use at an assay dependent concentration.

Target

  • Relevance

    Pertussis toxin (PT) is a protein-based AB5-type exotoxin produced by Bordetella pertussis. PT catalyzes the ADP-ribosylation of the alpha subunits of the heterotrimeric guanine nucleotide regulatory proteins Gi, Go, and Gt and prevents intracellular signal transduction by preventing the G proteins from interacting with G protein-coupled receptors on the cell membrane. PT consists of one molecule each of S1 (26 kDa), S2 (22 kDa), S3 (22 kDa), S5 (12 kDa) and two molecules of S4 (12 kDa).
  • Cellular localization

    Secreted
  • Database links

    see all
  • Alternative names

    • IAP S1 antibody
    • IAP S2 antibody
    • IAP S3 antibody
    • IAP S4 antibody
    • IAP S5 antibody
    • Islet activating protein S1 antibody
    • Islet activating protein S2 antibody
    • Islet activating protein S3 antibody
    • Islet activating protein S4 antibody
    • Islet activating protein S5 antibody
    • NAD dependent ADP ribosyltransferase antibody
    • Pertussis toxin subunit 1 antibody
    • Pertussis toxin subunit 2 antibody
    • Pertussis toxin subunit 3 antibody
    • Pertussis toxin subunit 4 antibody
    • Pertussis toxin subunit 5 antibody
    • PTX S1 antibody
    • PTX S2 antibody
    • PTX S3 antibody
    • PTX S4 antibody
    • PTX S5 antibody
    • PtxA antibody
    • PtxB antibody
    • PtxC antibody
    • PtxD antibody
    • PtxE antibody
    see all

Images

  • Anti-Pertussis toxin antibody (ab193494) at 2 µg/ml + Recombinant Bordella pertussis pertussis toxin subunit 1 at 0.1 µg

    Secondary
    Polyclonal goat anti-rabbit IgG at 1/1000 dilution

    Predicted band size: 30 kDa
    Observed band size: 36 kDa
    why is the actual band size different from the predicted?

References

ab193494 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193494.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up