Overview

  • Product name

  • Description

    Rabbit polyclonal to Pet1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Drosophila melanogaster
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 35-84 (PLSPAVQKGSGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEV A) of Human Pet1 (NP_059991).

  • Positive control

    • HeLa cell line lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab108265 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 25 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Functions as a transcriptional regulator. According to PubMed:12761502, it functions as a transcriptional repressor. Functions in the differentiation and the maintenance of the central serotonergic neurons. May play a role in cell growth.
  • Tissue specificity

    In brain, exclusively expressed in the major serotonergic neurons of the dorsal and median raphe nuclei located in the midbrain and pons. Also detected in prostate and small intestine.
  • Involvement in disease

    Genetic variation in FEV may be associated with susceptibility to sudden infant death syndrome (SIDS) [MIM:272120]. SIDS remains elusive in its causes and devastating in its consequences. Despite the impressive decline in the incidence of SIDS since the recommendation to avoid the prone sleep position, SIDS remains a leading cause of death in the first year of life.
    Note=A chromosomal aberration involving FEV is found in Ewing tumors. Translocation t(2;21;22)(q23;q22;q12) that forms a EWSR1-FEV fusion protein with a potential oncogenic activity.
  • Sequence similarities

    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • ETS-domain transcription factor antibody
    • FEV (ETS oncogene family) antibody
    • FEV antibody
    • FEV ETS transcription factor antibody
    • FEV_HUMAN antibody
    • Fifth Ewing sarcoma variant antibody
    • Fifth Ewing variant protein antibody
    • HSRNAFEV antibody
    • mPet1 antibody
    • PC12 ETS domain-containing transcription factor 1 antibody
    • PC12 ETS factor 1 antibody
    • Pet-1 antibody
    • Protein FEV antibody
    see all

Images

  • Anti-Pet1 antibody (ab108265) at 1 µg/ml + HeLa cell line lysate at 10 µg

    Predicted band size: 25 kDa



    Gel concentration: 12%

References

ab108265 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Thank you very much for your interest in ab108265 Anti-PET 1 antibody. To our knowledge this product has not been tested in rat. However a BLAST of the immunogen used showed 100% identity with rat. NP_653354.2Score = 106 bits (265), Expect = 3e-27,Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%) Therefore, I can offer a discount off a future purchase if you buy now, test it in rat and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of: 1 free PRIMARY ANTIBODY. If you are interested in this offer, please follow these steps: 1. I have created and included a unique discount code for use when testing Ab108265 in rat. Keep this code as it is needed when submitting the Abreview. 2. Purchase ab108265 either by phone, fax, or online (www.abcam.com). 3. Test it in rat. 4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). Be sure to include the code in the additional notes section. 5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and include the discount code. The discount can be redeemed for any PRIMARY ANTIBODY ordered and the discount code is valid for 4 months after issue. Please remember that submission of the Abreview is sufficient for the discount code to become active. Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research. For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews. The terms and conditions applicable to this offer can be found here: www.abcam.com/collaborationdiscount.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up