Overview

  • Product name

  • Description

    Rabbit polyclonal to Pet1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Pet1 aa 1-46.
    Sequence:

    MRQSGASQPLLINMYLPDPVGDGLFKDGKNPSWGPLSPAVQKGSGQ


    Database link: Q99581

  • Positive control

    • ICC/IF: SH-SY5Y cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221724 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Functions as a transcriptional regulator. According to PubMed:12761502, it functions as a transcriptional repressor. Functions in the differentiation and the maintenance of the central serotonergic neurons. May play a role in cell growth.
  • Tissue specificity

    In brain, exclusively expressed in the major serotonergic neurons of the dorsal and median raphe nuclei located in the midbrain and pons. Also detected in prostate and small intestine.
  • Involvement in disease

    Genetic variation in FEV may be associated with susceptibility to sudden infant death syndrome (SIDS) [MIM:272120]. SIDS remains elusive in its causes and devastating in its consequences. Despite the impressive decline in the incidence of SIDS since the recommendation to avoid the prone sleep position, SIDS remains a leading cause of death in the first year of life.
    Note=A chromosomal aberration involving FEV is found in Ewing tumors. Translocation t(2;21;22)(q23;q22;q12) that forms a EWSR1-FEV fusion protein with a potential oncogenic activity.
  • Sequence similarities

    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • ETS-domain transcription factor antibody
    • FEV (ETS oncogene family) antibody
    • FEV antibody
    • FEV ETS transcription factor antibody
    • FEV_HUMAN antibody
    • Fifth Ewing sarcoma variant antibody
    • Fifth Ewing variant protein antibody
    • HSRNAFEV antibody
    • mPet1 antibody
    • PC12 ETS domain-containing transcription factor 1 antibody
    • PC12 ETS factor 1 antibody
    • Pet-1 antibody
    • Protein FEV antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized SH-SY5Y (human neuroblastoma cell line from bone marrow) cells stained for Pet1 (green) using ab221724 at 4 µg/ml in ICC/IF. 

References

ab221724 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221724.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up