Overview

  • Product name

  • Description

    Rabbit polyclonal to PEX11B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC, WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human PEX11B aa 132-177 (internal sequence). NP_003837.1
    Sequence:

    IMNLSRDAYEIRLLMEQESSACSRRLKGSGGGVPGGSETGGLGGPG


    Database link: O96011

  • Positive control

    • Human breast tissue; MCF-7, Raw264.7 and PC12 cell lysates

Properties

Applications

Our Abpromise guarantee covers the use of ab211508 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200.
ICC 1/50 - 1/200.
WB 1/500 - 1/1000. Predicted molecular weight: 28 kDa.
IP 1/50 - 1/200.

Target

Images

  • All lanes : Anti-PEX11B antibody (ab211508) at 1/500 dilution

    Lane 1 : MCF-7 cell lysate
    Lane 2 : Raw264.7 cell lysate
    Lane 3 : PC12 cell lysate

    Predicted band size: 28 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human breast tissue labeling PEX11B with ab211508 at a 1/200 dilution.

References

ab211508 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211508.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up