Overview

  • Product name

  • Description

    Rabbit polyclonal to PEX13
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human PEX13 aa 1-130.
    Sequence:

    MASQPPPPPKPWETRRIPGAGPGPGPGPTFQSADLGPTLMTRPGQPALTR VPPPILPRPSQQTGSSSVNTFRPAYSSFSSGYGAYGNSFYGGYSPYSYGY NGLGYNRLRVDDLPPSRFVQQAEESSRGAF


    Database link: Q92968

  • Positive control

    • WB: Rat brain tissue lysate. IHC-P: Human adrenal gland tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235043 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 44 kDa.
IHC-P 1/200 - 1/500.

Target

  • Function

    Component of the peroxisomal translocation machinery with PEX14 and PEX17. Functions as a docking factor for the predominantly cytoplasmic PTS1 receptor (PAS10/PEX5). Involved in the import of PTS1 and PTS2 proteins.
  • Involvement in disease

    Defects in PEX13 are the cause of peroxisome biogenesis disorder complementation group 13 (PBD-CG13) [MIM:601789]; also known as PBD-CGH. PBD-CG13 is a peroxisomal disorder arising from a failure of protein import into the peroxisomal membrane or matrix. The peroxisome biogenesis disorders (PBD group) are genetically heterogeneous with at least 14 distinct genetic groups as concluded from complementation studies. Include disorders are: Zellweger syndrome (ZWS), neonatal adrenoleukodystrophy (NALD), infantile Refsum disease (IRD), and classical rhizomelic chondrodysplasia punctata (RCDP). ZWS, NALD and IRD are distinct from RCDP and constitute a clinical continuum of overlapping phenotypes known as the Zellweger spectrum (PBD-ZSS).
    Defects in PEX13 are a cause of adrenoleukodystrophy neonatal (NALD) [MIM:202370]. NALD is a peroxisome biogenesis disorder (PBD) characterized by the accumulation of very long-chain fatty acids, adrenal insufficiency and mental retardation.
  • Sequence similarities

    Belongs to the peroxin-13 family.
    Contains 1 SH3 domain.
  • Cellular localization

    Peroxisome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2610008O20Rik antibody
    • NALD antibody
    • OTTMUSP00000005454 antibody
    • Peroxin 13 antibody
    • Peroxin-13 antibody
    • Peroxin13 antibody
    • Peroxisomal membrane protein PEX 13 antibody
    • Peroxisomal membrane protein PEX13 antibody
    • Peroxisome biogenesis factor 13 antibody
    • PEX 13 antibody
    • pex13 antibody
    • PEX13_HUMAN antibody
    • RP23-188K3.1 antibody
    • ZWS antibody
    see all

Images

  • Paraffin-embedded human adrenal gland tissue stained for PEX13 using ab235043 at 1/200 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Anti-PEX13 antibody (ab235043) at 1/500 dilution + Rat brain tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 44 kDa

References

ab235043 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235043.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up