Overview

  • Product name

  • Description

    Rabbit polyclonal to PEX26
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human PEX26 aa 1-159.
    Sequence:

    MKSDSSTSAAPLRGLGGPLRSSEPVRAVPARAPAVDLLEEAADLLVVHLD FRAALETCERAWQSLANHAVAEEPAGTSLEVKCSLCVVGIQALAEMDRWQ EVLSWVLQYYQVPEKLPPKVLELCILLYSKMQEPGAVLDVVGAWLQDPAN QNLPEYGAL


    Database link: Q7Z412

  • Positive control

    • WB: K562 whole cell lysate. IHC-P: Human colon cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235084 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.
WB 1/500 - 1/5000. Predicted molecular weight: 34 kDa.

Target

  • Relevance

    PEX26 is probably required for protein import into peroxisomes. It anchors PEX1 and PEX6 to peroxisome membranes, possibly to form heteromeric AAA ATPase complexes required for the import of proteins into peroxisomes. Defects in the PEX26 gene are the cause of peroxisome biogenesis disorder complementation group 8 (PBD-CG8), which is a a group of peroxisomal disorders arising from a failure of protein import into the peroxisomal membrane or matrix.
  • Cellular localization

    Peroxisome membrane.
  • Database links

    • Alternative names

      • 4632428M11Rik antibody
      • AI85321 antibody
      • FLJ20695 antibody
      • OTTMUSP00000033411 antibody
      • OTTMUSP00000033413 antibody
      • PBD7A antibody
      • PBD7B antibody
      • Peroxin 26 antibody
      • Peroxisome assembly protein 26 antibody
      • Peroxisome biogenesis disorder, complementation group 8 antibody
      • Peroxisome biogenesis disorder, complementation group A antibody
      • Peroxisome biogenesis factor 26 antibody
      • PEX 26 antibody
      • PEX26M1T antibody
      • Pex26pM1T antibody
      see all

    Images

    • Anti-PEX26 antibody (ab235084) at 1/500 dilution + K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate

      Secondary
      Goat polyclonal to rabbit IgG at 1/50000 dilution

      Predicted band size: 34 kDa

    • Paraffin-embedded human colon cancer tissue stained for PEX26 using ab235084 at 1/400 dilution in immunohistochemical analysis.

      After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

    References

    ab235084 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab235084.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up